StarFunc result for job id Q9Y3R0

User Input

>input (1128 residues)
MIAVSFKCRCQILRRLTKDESPYTKSASQTKPPDGALAVRRQSIPEEFKGSTVVELMKKE
GTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISL
LKNVGERVVLEVEYELPPVSVQGSSVIFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPV
VITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEAALLIEYDVSV
MDSVATASGPLLVEVAKTPGASLGVALTTSMCCNKQVIVIDKIKSASIADRCGALHVGDH
ILSIDGTSMEYCTLAEATQFLANTTDQVKLEILPHHQTRLALKGPDHVKIQRSDRQLTWD
SWASNHSSLHTNHHYNTYHPDHCRVPALTFPKAPPPNSPPALVSSSFSPTSMSAYSLSSL
NMGTLPRSLYSTSPRGTMMRRRLKKKDFKSSLSLASSTVGLAGQVVHTETTEVVLTADPV
TGFGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEA
SQLLRDSSITSKVTLEIEFDVAESVIPSSGTFHVKLPKKHNVELGITISSPSSRKPGDPL
VISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDN
SDEQESSGAIIYTVELKRYGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRI
LAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQSASSPKKFPISSHLSDLGDVEE
DSSPAQKPGKLSDMYPSTVPSVDSAVDSWDGSAIDTSYGTQGTSFQASGYNFNTYDWRSP
KQRGSLSPVTKPRSQTYPDVGLSYEDWDRSTASGFAGAADSAETEQEENFWSQALEDLET
CGQSGILRELEEKADRRVSLRNMTLLATIMSGSTMSLNHEAPTPRSQLGRQASFQERSSS
RPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKEIMSPTPVELHKVTLYKDSDMEDFGFSV
ADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDL
VISRNPLASQKSIDQQSLPGDWSEQNSAFFQQPSHGGNLETREPTNTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8E0R9	0.310	0.321	0.000	1083	0.582	0.606	A8E0R9.pdb.gz	GRIP2_XENLA Glutamate receptor-interacting protein 2 OS=Xenopus laevis OX=8355 GN=grip2 PE=2 SV=2
2	AFDB:E0CXS4	0.352	0.389	0.000	1001	0.563	0.634	E0CXS4.pdb.gz	E0CXS4_MOUSE Glutamate receptor interacting protein 2 OS=Mus musculus OX=10090 GN=Grip2 PE=1 SV=1
3	AFDB:Q9C0E4	0.317	0.340	0.000	1043	0.558	0.603	Q9C0E4.pdb.gz	GRIP2_HUMAN Glutamate receptor-interacting protein 2 OS=Homo sapiens OX=9606 GN=GRIP2 PE=1 SV=4
4	AFDB:Q9WTW1	0.288	0.310	0.000	1043	0.571	0.617	Q9WTW1.pdb.gz	GRIP2_RAT Glutamate receptor-interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Grip2 PE=1 SV=1
5	AFDB:Q9Y3R0	1.000	1.000	0.000	1128	1.000	1.000	Q9Y3R0.pdb.gz	GRIP1_HUMAN Glutamate receptor-interacting protein 1 OS=Homo sapiens OX=9606 GN=GRIP1 PE=1 SV=3
6	AFDB:Q4H4B6	0.135	0.094	4.272E-28	1724	0.175	0.114	Q4H4B6.pdb.gz	SCRIB_DANRE Protein scribble homolog OS=Danio rerio OX=7955 GN=scrib PE=1 SV=1
7	AFDB:A0A2R8QMK9	0.083	0.067	1.247E-17	1689	0.158	0.105	A0A2R8QMK9.pdb.gz
8	AFDB:O97758	0.083	0.055	1.384E-17	1769	0.157	0.100	O97758.pdb.gz	ZO1_CANLF Tight junction protein ZO-1 OS=Canis lupus familiaris OX=9615 GN=TJP1 PE=1 SV=1
9	AFDB:P39447	0.091	0.068	8.058E-17	1745	0.157	0.101	P39447.pdb.gz	ZO1_MOUSE Tight junction protein ZO-1 OS=Mus musculus OX=10090 GN=Tjp1 PE=1 SV=2
10	AFDB:D3Z8G7	0.087	0.105	2.048E-16	907	0.105	0.130	D3Z8G7.pdb.gz	D3Z8G7_RAT Tight junction protein 3 OS=Rattus norvegicus OX=10116 GN=Tjp3 PE=1 SV=3
11	PDB:2xkxA	0.079	0.120	3.040E-15	721	0.069	0.108	2xkxA.pdb.gz
12	PDB:7p73A	0.082	0.216	1.267E-6	420	0.020	0.052	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
13	PDB:7p70A	0.080	0.213	1.641E-6	407	0.028	0.079	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
14	PDB:6pcvA	0.093	0.131	1.729E-6	754	0.034	0.050	6pcvA.pdb.gz
15	PDB:7pc3A	0.075	0.203	1.917E-6	405	0.024	0.067	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
16	PDB:7qqmA	0.071	0.192	7.004E-6	413	0.024	0.065	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	PDB:7qqnC	0.073	0.194	1.780E-5	414	0.025	0.068	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:6t36A	0.075	0.821	2.559E-5	93	0.020	0.247	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
19	PDB:7pe9I	0.072	0.246	5.286E-5	317	0.020	0.069	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
20	PDB:3pv2B	0.071	0.177	5.863E-5	388	0.030	0.088	3pv2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8E0R9	0.0	1288	1083	0.593	0.618	GRIP2_XENLA Glutamate receptor-interacting protein 2 OS=Xenopus laevis OX=8355 GN=grip2 PE=2 SV=2
2	B0V3R3	0.0	734	736	0.361	0.553	B0V3R3_DANRE Glutamate receptor interacting protein 2 OS=Danio rerio OX=7955 GN=fi03h07 PE=4 SV=1
3	E0CXE0	0.0	993	821	0.465	0.638	E0CXE0_MOUSE Glutamate receptor interacting protein 2 OS=Mus musculus OX=10090 GN=Grip2 PE=1 SV=1
4	E0CXS4	0.0	1131	1001	0.551	0.621	E0CXS4_MOUSE Glutamate receptor interacting protein 2 OS=Mus musculus OX=10090 GN=Grip2 PE=1 SV=1
5	G3XA20	0.0	1223	1042	0.581	0.629	G3XA20_MOUSE Glutamate receptor interacting protein 2 OS=Mus musculus OX=10090 GN=Grip2 PE=1 SV=1
6	P97879	0.0	2117	1112	0.941	0.954	GRIP1_RAT Glutamate receptor-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Grip1 PE=1 SV=1
7	Q499W6	0.0	622	591	0.326	0.623	Q499W6_MOUSE Grip2 protein (Fragment) OS=Mus musculus OX=10090 GN=Grip2 PE=2 SV=1
8	Q925T6	0.0	2187	1127	0.958	0.959	GRIP1_MOUSE Glutamate receptor-interacting protein 1 OS=Mus musculus OX=10090 GN=Grip1 PE=1 SV=1
9	Q9C0E4	0.0	1186	1043	0.560	0.606	GRIP2_HUMAN Glutamate receptor-interacting protein 2 OS=Homo sapiens OX=9606 GN=GRIP2 PE=1 SV=4
10	Q9WTW1	0.0	1206	1043	0.583	0.631	GRIP2_RAT Glutamate receptor-interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Grip2 PE=1 SV=1
11	Q9Y3R0	0.0	2317	1128	1.000	1.000	GRIP1_HUMAN Glutamate receptor-interacting protein 1 OS=Homo sapiens OX=9606 GN=GRIP1 PE=1 SV=3
12	E0CYS1	4.53e-56	194	174	0.084	0.546	E0CYS1_MOUSE Glutamate receptor interacting protein 2 OS=Mus musculus OX=10090 GN=Grip2 PE=1 SV=1
13	Q9W450	2.52e-35	148	1058	0.100	0.107	Q9W450_DROME FI03335p OS=Drosophila melanogaster OX=7227 GN=Grip PE=1 SV=2
14	Q8SY14	2.68e-35	148	1058	0.100	0.107	Q8SY14_DROME RE14068p OS=Drosophila melanogaster OX=7227 GN=Grip PE=2 SV=1
15	X2JIJ6	4.48e-35	147	1057	0.100	0.107	X2JIJ6_DROME Glutamate receptor interacting protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Grip PE=4 SV=1
16	F7BQ55	4.42e-27	108	119	0.045	0.429	F7BQ55_MOUSE Glutamate receptor interacting protein 2 (Fragment) OS=Mus musculus OX=10090 GN=Grip2 PE=1 SV=1
17	P70175	1.74e-17	90.5	849	0.087	0.115	DLG3_MOUSE Disks large homolog 3 OS=Mus musculus OX=10090 GN=Dlg3 PE=1 SV=1
18	Q62936	2.35e-17	90.1	849	0.087	0.115	DLG3_RAT Disks large homolog 3 OS=Rattus norvegicus OX=10116 GN=Dlg3 PE=1 SV=1
19	Q91XM9	3.64e-17	89.4	852	0.098	0.130	DLG2_MOUSE Disks large homolog 2 OS=Mus musculus OX=10090 GN=Dlg2 PE=1 SV=2
20	Q63622	3.80e-17	89.4	852	0.098	0.130	DLG2_RAT Disks large homolog 2 OS=Rattus norvegicus OX=10116 GN=Dlg2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19805 DUF6288	0.0013	29.6	Family of unknown function (DUF6288)
2	PF02391 MoaE	2.2e+02	13.4	MoaE protein
3	PF00595 PDZ	1.7e-85	292.8	PDZ domain
4	PF13180 PDZ_2	8.5e-30	114.3	PDZ domain
5	PF17820 PDZ_6	2.3e-58	205.2	PDZ domain
6	PF02163 Peptidase_M50	3.2e-19	81.0	Peptidase family M50
7	PF14685 Tricorn_PDZ	9.3e-08	43.3	Tricorn protease PDZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000004095

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000007689	0.991	Glutamate receptor, ionotropic, AMPA 2
2	61853.ENSNLEP00000018251	0.895	Protein interacting with PRKCA 1
3	61853.ENSNLEP00000018295	0.889	Glutamate receptor, ionotropic, AMPA 3
4	61853.ENSNLEP00000016182	0.885	Chondroitin sulfate proteoglycan 4
5	61853.ENSNLEP00000020057	0.880	Glutamate receptor, ionotropic, AMPA 1
6	61853.ENSNLEP00000018707	0.839	Estrogen receptor
7	61853.ENSNLEP00000008788	0.827	Glutamate receptor, ionotropic, AMPA 4
8	61853.ENSNLEP00000005940	0.817	N-ethylmaleimide sensitive factor, vesicle fusing ATPase
9	61853.ENSNLEP00000011915	0.764	Nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
10	61853.ENSNLEP00000000331	0.755	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
11	61853.ENSNLEP00000010151	0.742	Fraser extracellular matrix complex subunit 1
12	61853.ENSNLEP00000007945	0.741	Cadherin 2
13	61853.ENSNLEP00000015037	0.734	Coactivator-associated arginine methyltransferase 1
14	61853.ENSNLEP00000022896	0.734	Uncharacterized protein
15	61853.ENSNLEP00000018748	0.729	E1A binding protein p300
16	61853.ENSNLEP00000010168	0.724	EPH receptor B2
17	61853.ENSNLEP00000009694	0.715	GRIP1 associated protein 1
18	61853.ENSNLEP00000002678	0.714	Calcium/calmodulin-dependent serine protein kinase (MAGUK family)
19	61853.ENSNLEP00000009610	0.709	ephrin-B2
20	61853.ENSNLEP00000013286	0.691	GRIP and coiled-coil domain containing 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008013	0.529	beta-catenin binding
GO:0035259	0.521	nuclear glucocorticoid receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0051179	0.997	localization
GO:0065007	0.992	biological regulation
GO:0032501	0.983	multicellular organismal process
GO:0050794	0.977	regulation of cellular process
GO:0006810	0.967	transport
GO:0065008	0.944	regulation of biological quality
GO:0051641	0.937	cellular localization
GO:0099072	0.931	regulation of postsynaptic membrane neurotransmitter receptor levels
GO:0045184	0.917	establishment of protein localization
GO:0016197	0.912	endosomal transport
GO:0071705	0.908	nitrogen compound transport
GO:0050896	0.899	response to stimulus
GO:0015031	0.878	protein transport
GO:0006886	0.805	intracellular protein transport
GO:0007154	0.785	cell communication
GO:0072657	0.775	protein localization to membrane
GO:0051716	0.745	cellular response to stimulus
GO:0062237	0.702	protein localization to postsynapse
GO:1990778	0.699	protein localization to cell periphery
GO:0048856	0.679	anatomical structure development
GO:0031503	0.674	protein-containing complex localization
GO:1903539	0.651	protein localization to postsynaptic membrane
GO:0023052	0.639	signaling
GO:0098876	0.635	vesicle-mediated transport to the plasma membrane
GO:0097120	0.620	receptor localization to synapse
GO:0090150	0.598	establishment of protein localization to membrane
GO:0007275	0.597	multicellular organism development
GO:0061951	0.592	establishment of protein localization to plasma membrane
GO:0099003	0.587	vesicle-mediated transport in synapse
GO:0032456	0.556	endocytic recycling
GO:0007165	0.550	signal transduction
GO:0048518	0.508	positive regulation of biological process
GO:0048522	0.492	positive regulation of cellular process
GO:0071704	0.490	organic substance metabolic process
GO:0043170	0.458	macromolecule metabolic process
GO:0044238	0.439	primary metabolic process
GO:0006807	0.434	nitrogen compound metabolic process
GO:0071840	0.428	cellular component organization or biogenesis
GO:0019538	0.412	protein metabolic process
GO:0048519	0.394	negative regulation of biological process
GO:0030154	0.391	cell differentiation
GO:0016043	0.381	cellular component organization
GO:0048731	0.375	system development
GO:0023051	0.373	regulation of signaling
GO:0048523	0.370	negative regulation of cellular process
GO:0065009	0.364	regulation of molecular function
GO:0010646	0.364	regulation of cell communication
GO:0007166	0.334	cell surface receptor signaling pathway
GO:0051239	0.303	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.996	plasma membrane
GO:0005622	0.985	intracellular anatomical structure
GO:0045202	0.979	synapse
GO:0043005	0.979	neuron projection
GO:0005737	0.978	cytoplasm
GO:0005829	0.952	cytosol
GO:0036477	0.911	somatodendritic compartment
GO:0030425	0.898	dendrite
GO:0098794	0.891	postsynapse
GO:0044309	0.793	neuron spine
GO:0043226	0.761	organelle
GO:0098978	0.539	glutamatergic synapse
GO:0030424	0.508	axon
GO:0043197	0.474	dendritic spine
GO:0043229	0.471	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]