StarFunc result for job id Q9Y3R4

User Input

>input (380 residues)
MASLPVLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYD
APTHQVQWQAQEVVAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRAN
VTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLHDRARSLVVPAYA
YRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHL
RARVQAQSTNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTH
SWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGCLYEANDYE
EIVFLMFTLKQAFPAEYLPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y3R4	1.000	1.000	4.728E-81	380	1.000	1.000	Q9Y3R4.pdb.gz	NEUR2_HUMAN Sialidase-2 OS=Homo sapiens OX=9606 GN=NEU2 PE=1 SV=2
2	PDB:2f25A	0.977	0.996	1.258E-73	373	0.976	0.995	2f25A.pdb.gz	Crystal Structure of the Human Sialidase Neu2 E111Q Mutant in Complex with DANA Inhibitor
3	AFDB:Q9JMH3	0.984	0.987	2.657E-65	379	0.684	0.686	Q9JMH3.pdb.gz	NEUR2_MOUSE Sialidase-2 OS=Mus musculus OX=10090 GN=Neu2 PE=1 SV=1
4	AFDB:Q64627	0.979	0.982	7.459E-64	379	0.663	0.665	Q64627.pdb.gz	NEUR2_RAT Sialidase-2 OS=Rattus norvegicus OX=10116 GN=Neu2 PE=1 SV=1
5	AFDB:Q8WWR8	0.929	0.733	7.288E-46	484	0.447	0.351	Q8WWR8.pdb.gz	NEUR4_HUMAN Sialidase-4 OS=Homo sapiens OX=9606 GN=NEU4 PE=1 SV=3
6	AFDB:A7TUD5	0.899	0.837	1.961E-45	409	0.397	0.369	A7TUD5.pdb.gz
7	AFDB:Q8BZL1	0.911	0.729	2.270E-44	478	0.447	0.356	Q8BZL1.pdb.gz	NEUR4_MOUSE Sialidase-4 OS=Mus musculus OX=10090 GN=Neu4 PE=1 SV=3
8	AFDB:Q503Z4	0.915	0.814	2.520E-44	429	0.445	0.394	Q503Z4.pdb.gz	Q503Z4_DANRE exo-alpha-sialidase OS=Danio rerio OX=7955 GN=zgc:109998 PE=2 SV=1
9	AFDB:Q9JMH7	0.917	0.836	3.104E-44	418	0.418	0.380	Q9JMH7.pdb.gz	NEUR3_MOUSE Sialidase-3 OS=Mus musculus OX=10090 GN=Neu3 PE=1 SV=1
10	AFDB:A7MCG3	0.890	0.900	1.923E-43	376	0.395	0.399	A7MCG3.pdb.gz
11	AFDB:O97859	0.887	0.791	4.426E-43	428	0.426	0.379	O97859.pdb.gz	NEUR3_BOVIN Sialidase-3 OS=Bos taurus OX=9913 GN=NEU3 PE=1 SV=1
12	PDB:2xzjA	0.682	0.672	3.231E-16	386	0.216	0.212	2xzjA.pdb.gz	The Aspergillus Fumigatus Sialidase is a Kdnase: Structural and Mechanistic Insights.
13	PDB:3t1eA	0.651	0.564	3.824E-12	447	0.134	0.114	3t1eA.pdb.gz
14	PDB:4jf7A	0.645	0.509	8.271E-11	501	0.126	0.096	4jf7A.pdb.gz	Structure of the Parainfluenza Virus 5 (PIV5) Hemagglutinin-Neuraminidase (HN) Ectodomain.
15	PDB:7syyA	0.622	0.580	1.120E-9	413	0.108	0.099	7syyA.pdb.gz	Potent monoclonal antibody-mediated neutralization of a divergent Hendra virus variant.
16	PDB:5eo8A	0.522	0.620	1.485E-6	311	0.121	0.148	5eo8A.pdb.gz	Six independent fucose-binding sites in the crystal structure of Aspergillus oryzae lectin
17	PDB:4a7zA	0.487	0.249	2.924E-6	881	0.155	0.067	4a7zA.pdb.gz	Crystal Structure of Bifunctional Aldos-2-Ulose Dehydratase/Isomerase from Phanerochaete Chrysosporium with the Reaction Intermediate Ascopyrone M.
18	PDB:5jozA	0.403	0.323	1.133E-5	507	0.097	0.073	5jozA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
19	PDB:5nmtB	0.293	0.197	2.010E-5	657	0.092	0.053	5nmtB.pdb.gz
20	PDB:4i79B	0.416	0.475	2.118E-5	316	0.089	0.108	4i79B.pdb.gz	Crystal structure of human nuclear pore complex component NUP43.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q64627	0.0	531	379	0.663	0.665	NEUR2_RAT Sialidase-2 OS=Rattus norvegicus OX=10116 GN=Neu2 PE=1 SV=1
2	Q9JMH3	0.0	548	379	0.684	0.686	NEUR2_MOUSE Sialidase-2 OS=Mus musculus OX=10090 GN=Neu2 PE=1 SV=1
3	Q9Y3R4	0.0	785	380	1.000	1.000	NEUR2_HUMAN Sialidase-2 OS=Homo sapiens OX=9606 GN=NEU2 PE=1 SV=2
4	Q503Z4	1.19e-94	291	429	0.439	0.389	Q503Z4_DANRE exo-alpha-sialidase OS=Danio rerio OX=7955 GN=zgc:109998 PE=2 SV=1
5	A0JMM3	4.15e-88	273	402	0.432	0.408	A0JMM3_DANRE exo-alpha-sialidase OS=Danio rerio OX=7955 GN=neuc.1 PE=1 SV=1
6	I3ITP7	1.66e-85	266	398	0.382	0.364	I3ITP7_DANRE exo-alpha-sialidase OS=Danio rerio OX=7955 GN=im:7158396 PE=3 SV=1
7	A0PJS4	2.11e-85	266	394	0.382	0.368	A0PJS4_DANRE exo-alpha-sialidase OS=Danio rerio OX=7955 GN=im:7158396 PE=2 SV=1
8	O97859	1.03e-83	263	428	0.432	0.383	NEUR3_BOVIN Sialidase-3 OS=Bos taurus OX=9913 GN=NEU3 PE=1 SV=1
9	Q9UQ49	1.30e-83	263	428	0.429	0.381	NEUR3_HUMAN Sialidase-3 OS=Homo sapiens OX=9606 GN=NEU3 PE=1 SV=1
10	Q4V9A4	6.06e-83	259	376	0.384	0.388	Q4V9A4_DANRE exo-alpha-sialidase OS=Danio rerio OX=7955 GN=zgc:100806 PE=1 SV=1
11	Q9JMH7	1.80e-81	257	418	0.432	0.392	NEUR3_MOUSE Sialidase-3 OS=Mus musculus OX=10090 GN=Neu3 PE=1 SV=1
12	G3XKV7	7.78e-77	244	389	0.400	0.391	G3XKV7_ORYLA exo-alpha-sialidase OS=Oryzias latipes OX=8090 GN=Neu3b PE=2 SV=1
13	Q8WWR8	2.20e-70	230	484	0.424	0.333	NEUR4_HUMAN Sialidase-4 OS=Homo sapiens OX=9606 GN=NEU4 PE=1 SV=3
14	Q8BZL1	3.75e-64	214	478	0.334	0.266	NEUR4_MOUSE Sialidase-4 OS=Mus musculus OX=10090 GN=Neu4 PE=1 SV=3
15	Q5JQI0	4.43e-12	69.3	415	0.268	0.246	Q5JQI0_HUMAN exo-alpha-sialidase OS=Homo sapiens OX=9606 GN=NEU1 PE=2 SV=1
16	Q99519	4.43e-12	69.3	415	0.268	0.246	NEUR1_HUMAN Sialidase-1 OS=Homo sapiens OX=9606 GN=NEU1 PE=1 SV=1
17	Q99PW3	1.24e-11	67.8	409	0.271	0.252	NEUR1_RAT Sialidase-1 OS=Rattus norvegicus OX=10116 GN=Neu1 PE=1 SV=1
18	O35657	2.02e-11	67.4	409	0.271	0.252	NEUR1_MOUSE Sialidase-1 OS=Mus musculus OX=10090 GN=Neu1 PE=1 SV=1
19	Q8XMY5	3.18e-08	58.2	1173	0.182	0.059	Q8XMY5_CLOPE Exo-alpha-sialidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nanJ PE=1 SV=1
20	Q4WQS0	3.49e-05	47.8	406	0.197	0.185	SIA_ASPFU Exo-alpha-sialidase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_4G13800 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02012 BNR	0.53	21.2	BNR/Asp-box repeat
2	PF13088 BNR_2	9.6e-50	181.0	BNR repeat-like domain
3	PF13859 BNR_3	0.51	21.2	BNR repeat-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000233840

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385735	0.948	Galactosylceramide sulfotransferase
2	9606.ENSP00000311648	0.925	2-hydroxyacylsphingosine 1-beta-galactosyltransferase
3	9606.ENSP00000218516	0.922	Galactosidase alpha
4	9606.ENSP00000261304	0.917	Galactocerebrosidase
5	9606.ENSP00000216124	0.904	Arylsulfatase A
6	9606.ENSP00000405482	0.797	Putative transporter SVOPL
7	9606.ENSP00000285928	0.742	Leucine-rich repeat and guanylate kinase domain-containing protein
8	9606.ENSP00000260010	0.703	Toll-like receptor 2
9	9606.ENSP00000295759	0.687	Beta-galactosidase-1-like protein
10	9606.ENSP00000266544	0.684	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
11	9606.ENSP00000342222	0.669	Transient receptor potential cation channel subfamily V member 2
12	9606.ENSP00000264057	0.662	Diacylglycerol kinase delta
13	9606.ENSP00000405338	0.650	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
14	9606.ENSP00000192314	0.647	Galactose-3-O-sulfotransferase 2
15	9606.ENSP00000304802	0.642	Thymidylate kinase
16	9606.ENSP00000337572	0.636	Diacylglycerol kinase eta
17	9606.ENSP00000379680	0.633	Alpha-N-acetylgalactosaminidase
18	9606.ENSP00000396755	0.630	Cyclin N-terminal domain containing 2
19	9606.ENSP00000196371	0.618	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial
20	9606.ENSP00000262507	0.601	Ubiquinone biosynthesis protein COQ9, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004308	1.000	exo-alpha-sialidase activity
GO:0005515	0.997	protein binding
GO:0052794	0.868	exo-alpha-(2->3)-sialidase activity
GO:0052796	0.755	exo-alpha-(2->8)-sialidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0030149	0.988	sphingolipid catabolic process
GO:1901136	0.987	carbohydrate derivative catabolic process
GO:0043603	0.975	amide metabolic process
GO:1903509	0.970	liposaccharide metabolic process
GO:0006672	0.966	ceramide metabolic process
GO:0006687	0.959	glycosphingolipid metabolic process
GO:0009311	0.958	oligosaccharide metabolic process
GO:0016052	0.921	carbohydrate catabolic process
GO:0009313	0.903	oligosaccharide catabolic process
GO:0009100	0.842	glycoprotein metabolic process
GO:0006516	0.509	glycoprotein catabolic process
GO:0001573	0.493	ganglioside metabolic process
GO:0044262	0.406	cellular carbohydrate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0032991	0.905	protein-containing complex
GO:0016020	0.854	membrane
GO:0043227	0.836	membrane-bounded organelle
GO:0043229	0.830	intracellular organelle
GO:0043231	0.790	intracellular membrane-bounded organelle
GO:1902494	0.633	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.18	1.000	exo-alpha-sialidase.

[back to server]