StarFunc result for job id Q9Y3R5

User Input

>input (2298 residues)
MDPEEQELLNDYRYRSYSSVIEKALRNFESSSEWADLISSLGKLNKALQSNLRYSLLPRR
LLISKRLAQCLHPALPSGVHLKALETYEIIFKIVGTKWLAKDLFLYSCGLFPLLAHAAVS
VRPVLLTLYEKYFLPLQKLLLPSLQAFIVGLLPGLEEGSEISDRTDALLLRLSLVVGKEV
FYTALWGSVLASPSIRLPASVFVVGHINRDAPGREQKYMLGTNHQLTVKSLRASLLDSNV
LVQRNNLEIVLFFFPFYTCLDSNERAIPLLRSDIVRILSAATQTLLRRDMSLNRRLYAWL
LGSDIKGNTVVPESEISNSYEDQSSYFFEKYSKDLLVEGLAEILHQKFIDADVEERHHAY
LKPFRVLISLLDKPEIGPQVVGNLFLEVIRAFYSYCRDALGSDLKLSYTQSGNSLISAIK
ENRNASEIVKTVNLLITSLSTDFLWDYMTRCFEECFRPVKQRYSVRNSVSPPPTVSELCA
LLVFLLDVIPLELYSEVQTQYLPQVLGCLVQPLAEDMEALSLPELTHALKTCFKVLSKVQ
MPPSYLDTESTSGTSSPVKGENGKIILETKAVIPGDEDASFPPLKSEDSGIGLSASSPEL
SEHLRVPRVSLERDDVWKKGGSMQRTFLCIQELIANFASKNIFGVQLTASGEESKSEEPA
GKRDRDGTQSLAANDSSRKNSWEPKPITVPQFKQMLSDLFTARGSPFKTKSSESPSSSPS
SPARKNGGEWDVEKVVIDLGGSREERREAFAAACHLLLDCATFPVYLSEEETEQLCATLF
QLPGAGDSSFPSWLKSLMTICCCVTDCYLQNVAISTLLEVINHSQSLALVIEDKMKRYKS
SGHNPFFGKLQMVTVPPIAPGILKVIAEKTDFYQRVARVLWNQLNKETREHHVTCVELFY
RLHCLAPTANICEDIICHALLDPDKGTRLEALFRFSVIWHLTREIQGSRVTSHNRSFDRS
LFVVLDSLACTDGAIGAAAQGWLVRALSLGDVARILEPVLLLLLQPKTQRTSIHCLKQEN
SADDLHRWFNRKKTSFREACAVPEPQESGSEEHLPLSQFTTVDREAIWAEVEKEPEKYPL
RGELSEEELPYYVELPDRTAHGAPDSSEHTESADTSSCHTDSENTSSFSSPSHDLQELSN
EENCCAPIPMGGRAYPKRSALLAAFQSESFKAGAKLSLVRVDSDKTQASESFSSDEEADL
ELQALTTSRLLKQQRERQEAVEALFKHILLYLQPYDSRRVLYAFSVLEAVLKTNPKEFIE
AVSRTSMDTSSTAHLNLISNLLARHQEALIGQSFYGKLQTQVPNVCPHSLLLELLTYLCL
SFLRSYYPCYLKVSHRDILGNRDVQVKSVEVLIRIMMQLVSVAKSSEGKNVEFIHSLLQR
CKVQEFVLLSLSASMYTSQKRYGLATAHHGRALPEDSLFEESLINLGQDQIWSEHPLQIE
LLKLLQVLIVLEHHLGRAHEEAENQPDLSREWQRALNFQQAISALQYVQPHPLTSQGLLV
SAVVRGLQPAYGYGMHPAWVSLVTHSLPYFGKSLGWTVTPFVVQICKNLDDLVKQYESES
VKLSVSTTSKRENISPDYPLTLLEGLTTISHFCLLEQANQNKKTMAAGDPANLRNARNAI
LEELPRTVNTMALLWNVLRKEETQKRPVDLLGATKGSSSVYFKTTKTIRQKILDFLNPLT
AHLGVQLTAAVAAVWSRKKAQRHSKMKIIPTASASQLTLVDLVCALSTLQTDTLLHLVKE
VVKRPPQVKGGDEKSPLVDIPVLQFCYAFLQRLPVPALQENFSSLLGVLKESVQLNLAPP
GYFLLLSMLNDFVTRTPNLENKKDQKDLQEITQKILEAVGNIAGSSLEQTSWLSRNLEVK
AQPQASLEESDAEEDLYDAAAASAMVSSSAPSVYSVQALSLLAEVLASLLDMVYRSDEKE
KAVPLISRLLYYVFPYLRNHSAYNAPSFRAGAQLLSSLSGYAYTKRAWRKEVLELFLDPA
FFQMDTSCVHWKSIIDHLLTHEKTMFKDLMNMQSSSLKLFSSFEQKAMLLKRQAFAVFSG
ELDQYHLYLPLIQERLTDNLRVGQTSIVAAQMFLFFRVLLLRISPQHLTSLWPIMVSELI
QTFTQLEEDLKDEDESLRSTNKVNRTKVSVPDANGPSVGEIPQSELILYLSACKFLDTAL
SFPPDKMPLFQIYRWAFIPEVDTEGPAFLSDVEENHQECKPHTVRILELLKLKFGEISSS
DEITMKSEFPLLRQHSVSSIRQLMPFFMTLNGAFKTQRQLPADSPGTPFLDFPVTDSPRI
LKQLEECIEYDFLEHPEC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A0Y2	0.740	0.697	0.000	2452	0.404	0.379	D4A0Y2.pdb.gz	D4A0Y2_RAT DOP1 leucine zipper like protein A OS=Rattus norvegicus OX=10116 GN=Dop1a PE=1 SV=3
2	AFDB:Q9Y3R5	1.000	1.000	0.000	2298	1.000	1.000	Q9Y3R5.pdb.gz	DOP2_HUMAN Protein dopey-2 OS=Homo sapiens OX=9606 GN=DOP1B PE=1 SV=5
3	AFDB:Q9C0Z4	0.257	0.337	7.106E-35	1687	0.152	0.207	Q9C0Z4.pdb.gz	DOP1_SCHPO Protein dopey OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB21F2.02 PE=1 SV=1
4	PDB:7w7gB	0.280	0.350	9.305E-11	1711	0.101	0.135	7w7gB.pdb.gz	Structure and mechanism of NALCN-FAM155A-UNC79-UNC80 channel complex.
5	PDB:7mqaLM	0.106	0.116	1.822E-9	2041	0.112	0.126	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
6	PDB:7m6aA	0.125	0.080	7.767E-9	4306	0.107	0.057	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
7	PDB:7sukSP	0.116	0.118	9.708E-9	2234	0.119	0.122	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
8	PDB:7tyrA	0.086	0.064	1.574E-8	3905	0.122	0.072	7tyrA.pdb.gz
9	PDB:7su3A	0.097	0.069	2.553E-8	3802	0.117	0.071	7su3A.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
10	PDB:7ajuUT	0.094	0.094	2.962E-8	2313	0.128	0.127	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
11	PDB:7sx3E	0.302	0.393	3.074E-8	1611	0.107	0.152	7sx3E.pdb.gz	Structural architecture of the human NALCN channelosome.
12	PDB:7tzcA	0.111	0.071	3.567E-8	4404	0.101	0.053	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
13	PDB:7mq8SP	0.107	0.120	3.702E-8	1993	0.116	0.133	7mq8SP.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	AFDB:Q62769	0.103	0.128	5.516E-4	1622	0.067	0.094	Q62769.pdb.gz	UN13B_RAT Protein unc-13 homolog B OS=Rattus norvegicus OX=10116 GN=Unc13b PE=1 SV=2
15	AFDB:Q9SIC9	0.064	0.117	1.505E-3	918	0.057	0.144	Q9SIC9.pdb.gz	PP178_ARATH Pentatricopeptide repeat-containing protein GUN1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GUN1 PE=2 SV=1
16	AFDB:Q498H0	0.099	0.137	3.540E-3	1448	0.069	0.110	Q498H0.pdb.gz	PD5BA_XENLA Sister chromatid cohesion protein PDS5 homolog B-A OS=Xenopus laevis OX=8355 GN=pds5b-a PE=1 SV=1
17	AFDB:O74304	0.065	0.090	4.425E-3	1436	0.047	0.075	O74304.pdb.gz	WIN1_SCHPO MAP kinase kinase kinase win1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=win1 PE=1 SV=1
18	AFDB:Q7TPV4	0.090	0.120	5.329E-3	1344	0.080	0.137	Q7TPV4.pdb.gz	MBB1A_MOUSE Myb-binding protein 1A OS=Mus musculus OX=10090 GN=Mybbp1a PE=1 SV=2
19	AFDB:Q99959	0.081	0.169	5.740E-3	881	0.044	0.114	Q99959.pdb.gz	PKP2_HUMAN Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2 PE=1 SV=2
20	AFDB:Q8BIZ8	0.079	0.142	7.446E-3	905	0.053	0.134	Q8BIZ8.pdb.gz	Q8BIZ8_MOUSE S phase cyclin A-associated protein in the ER OS=Mus musculus OX=10090 GN=Scaper PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A0N6	0.0	725	2453	0.185	0.173	A0A8I6A0N6_RAT DOP1 leucine zipper like protein A OS=Rattus norvegicus OX=10116 GN=Dop1a PE=3 SV=1
2	D4A0Y2	0.0	733	2443	0.185	0.174	D4A0Y2_RAT DOP1 leucine zipper like protein A OS=Rattus norvegicus OX=10116 GN=Dop1a PE=1 SV=3
3	Q9Y3R5	0.0	4717	2298	1.000	1.000	DOP2_HUMAN Protein dopey-2 OS=Homo sapiens OX=9606 GN=DOP1B PE=1 SV=5
4	Q9Y7B3	2.54e-50	200	1858	0.067	0.083	DOP1_EMENI Protein dopey OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=dop1 PE=1 SV=1
5	Q9C0Z4	4.42e-45	182	1687	0.058	0.079	DOP1_SCHPO Protein dopey OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB21F2.02 PE=1 SV=1
6	Q03921	3.50e-31	137	1698	0.056	0.075	DOP1_YEAST Protein dopey OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DOP1 PE=1 SV=1
7	F4I321	2.7	35.4	347	0.007	0.043	F4I321_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g22910 PE=1 SV=1
8	Q38FQ5	7.4	34.3	606	0.016	0.061	Q38FQ5_TRYB2 Transmembrane transport protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.1310 PE=4 SV=1
9	D2CSU5	9.9	33.1	263	0.009	0.076	CM2_PETHY Chorismate mutase 2 OS=Petunia hybrida OX=4102 GN=CM2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04118 Dopey_N	2.3e-89	311.2	Dopey, N-terminal
2	PF11701 UNC45-central	2.1e+02	13.3	Myosin-binding striated muscle assembly central

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382104

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377250	0.932	Protein MON2 homolog
2	9606.ENSP00000436785	0.834	Solute carrier family 35 member F2
3	9606.ENSP00000384966	0.781	Mitochondrial inner membrane protease subunit 2
4	9606.ENSP00000430733	0.719	CUB and sushi domain-containing protein 1
5	9606.ENSP00000328992	0.679	PAX3- and PAX7-binding protein 1
6	9606.ENSP00000479365	0.641	Heterogeneous nuclear ribonucleoprotein C-like 1
7	9606.ENSP00000282272	0.630	Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B
8	9606.ENSP00000439768	0.624	Belongs to the UPF0220 family
9	9606.ENSP00000355114	0.608	DDB1- and CUL4-associated factor 12
10	9606.ENSP00000299847	0.596	CHRNA7-FAM7A fusion protein
11	9606.ENSP00000380877	0.593	Activating signal cointegrator 1 complex subunit 2
12	9606.ENSP00000266087	0.590	F-box only protein 7
13	9606.ENSP00000382250	0.588	Mitochondrial ribosomal protein S6
14	9606.ENSP00000464087	0.558	E3 ubiquitin-protein ligase RNF213
15	9606.ENSP00000330753	0.549	Bromodomain and WD repeat-containing protein 1
16	9606.ENSP00000342481	0.539	Probable phospholipid-transporting ATPase IIA
17	9606.ENSP00000353557	0.536	Solute carrier family 35 member F1
18	9606.ENSP00000291670	0.516	Formimidoyltransferase-cyclodeaminase
19	9606.ENSP00000274498	0.510	Rho GTPase-activating protein 26
20	9606.ENSP00000385142	0.508	Neurexin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.800	developmental process
GO:0048856	0.794	anatomical structure development
GO:0032501	0.778	multicellular organismal process
GO:0007275	0.760	multicellular organism development
GO:0009987	0.673	cellular process
GO:0050890	0.673	cognition
GO:0065007	0.642	biological regulation
GO:0007389	0.614	pattern specification process
GO:0009880	0.579	embryonic pattern specification
GO:0050789	0.519	regulation of biological process
GO:0050794	0.404	regulation of cellular process
GO:0071704	0.356	organic substance metabolic process
GO:0044237	0.316	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0031410	0.999	cytoplasmic vesicle
GO:0031090	0.996	organelle membrane
GO:0005576	0.992	extracellular region
GO:0098588	0.982	bounding membrane of organelle
GO:0070062	0.981	extracellular exosome
GO:0005768	0.981	endosome
GO:0030659	0.974	cytoplasmic vesicle membrane
GO:0010008	0.961	endosome membrane
GO:0005769	0.956	early endosome
GO:0031901	0.945	early endosome membrane
GO:0005829	0.937	cytosol
GO:0005634	0.515	nucleus
GO:0071944	0.369	cell periphery
GO:0005886	0.311	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]