StarFunc result for job id Q9Y3S1

User Input

>input (2297 residues)
MDGDGGRRDVPGTLMEPGRGAGPAGMAEPRAKAARPGPQRFLRRSVVESDQEEPPGLEAA
EAPGPQPPQPLQRRVLLLCKTRRLIAERARGRPAAPAPAALVAQPGAPGAPADAGPEPVG
TQEPGPDPIAAAVETAPAPDGGPREEAAATVRKEDEGAAEAKPEPGRTRRDEPEEEEDDE
DDLKAVATSLDGRFLKFDIELGRGSFKTVYKGLDTETWVEVAWCELQDRKLTKLERQRFK
EEAEMLKGLQHPNIVRFYDFWESSAKGKRCIVLVTELMTSGTLKTYLKRFKVMKPKVLRS
WCRQILKGLLFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGT
PEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTCGIKPASFEK
VHDPEIKEIIGECICKNKEERYEIKDLLSHAFFAEDTGVRVELAEEDHGRKSTIALRLWV
EDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQ
WRRERIWPALQPKEQQDVGSPDKARGPPVPLQVQVTYHAQAGQPGPPEPEEPEADQHLLP
PTLPTSATSLASDSTFDSGQGSTVYSDSQSSQQSVMLGSLADAAPSPAQCVCSPPVSEGP
VLPQSLPSLGAYQQPTAAPGLPVGSVPAPACPPSLQQHFPDPAMSFAPVLPPPSTPMPTG
PGQPAPPGQQPPPLAQPTPLPQVLAPQPVVPLQPVPPHLPPYLAPASQVGAPAQLKPLQM
PQAPLQPLAQVPPQMPPIPVVPPITPLAGIDGLPPALPDLPTATVPPVPPPQYFSPAVIL
PSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPATIPLLAVAPPGVAALSIH
SAVAQLPGQPVYPAAFPQMAPTDVPPSPHHTVQNMRATPPQPALPPQPTLPPQPVLPPQP
TLPPQPVLPPQPTRPPQPVLPPQPMLPPQPVLPPQPALPVRPEPLQPHLPEQAAPAATPG
SQILLGHPAPYAVDVAAQVPTVPVPPAAVLSPPLPEVLLPAAPELLPQFPSSLATVSASV
QSVPTQTATLLPPANPPLPGGPGIASPCPTVQLTVEPVQEEQASQDKPPGLPQSCESYGG
SDVTSGKELSDSCEGAFGGGRLEGRAARKHHRRSTRARSRQERASRPRLTILNVCNTGDK
MVECQLETHNHKMVTFKFDLDGDAPDEIATYMVEHDFILQAERETFIEQMKDVMDKAEDM
LSEDTDADRGSDPGTSPPHLSTCGLGTGEESRQSQANAPVYQQNVLHTGKRWFIICPVAE
HPAPEAPESSPPLPLSSLPPEASQGPCRGLTLPCLPWRRAACGAVFLSLFSAESAQSKQP
PDSAPYKDQLSSKEQPSFLASQQLLSQAGPSNPPGAPPAPLAPSSPPVTALPQDGAAPAT
STMPEPASGTASQAGGPGTPQGLTSELETSQPLAETHEAPLAVQPLVVGLAPCTPAPEAA
STRDASAPREPLPPPAPEPSPHSGTPQPALGQPAPLLPAAVGAVSLATSQLPSPPLGPTV
PPQPPSALESDGEGPPPRVGFVDSTIKSLDEKLRTLLYQEHVPTSSASAGTPVEVGDRDF
TLEPLRGDQPRSEVCGGDLALPPVPKEAVSGRVQLPQPLVEKSELAPTRGAVMEQGTSSS
MTAESSPRSMLGYDRDGRQVASDSHVVPSVPQDVPAFVRPARVEPTDRDGGEAGESSAEP
PPSDMGTVGGQASHPQTLGARALGSPRKRPEQQDVSSPAKTVGRFSVVSTQDEWTLASPH
SLRYSAPPDVYLDEAPSSPDVKLAVRRAQTASSIEVGVGEPVSSDSGDEGPRARPPVQKQ
ASLPVSGSVAGDFVKKATAFLQRPSRAGSLGPETPSRVGMKVPTISVTSFHSQSSYISSD
NDSELEDADIKKELQSLREKHLKEISELQSQQKQEIEALYRRLGKPLPPNVGFFHTAPPT
GRRRKTSKSKLKAGKLLNPLVRQLKVVASSTGHLADSSRGPPAKDPAQASVGLTADSTGL
SGKAVQTQQPCSVRASLSSDICSGLASDGGGARGQGWTVYHPTSERVTYKSSSKPRARFL
SGPVSVSIWSALKRLCLGKEHSSRSSTSSLAPGPEPGPQPALHVQAQVNNSNNKKGTFTD
DLHKLVDEWTSKTVGAAQLKPTLNQLKQTQKLQDMEAQAGWAAPGEARAMTAPRAGVGMP
RLPPAPGPLSTTVIPGAAPTLSVPTPDGALGTARRNQVWFGLRVPPTACCGHSTQPRGGQ
RVGSKTASFAASDPVRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UH66	0.223	0.236	0.000	2149	0.761	0.813	Q3UH66.pdb.gz	WNK2_MOUSE Serine/threonine-protein kinase WNK2 OS=Mus musculus OX=10090 GN=Wnk2 PE=1 SV=2
2	AFDB:Q9Y3S1	0.999	0.999	0.000	2297	1.000	1.000	Q9Y3S1.pdb.gz	WNK2_HUMAN Serine/threonine-protein kinase WNK2 OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=4
3	AFDB:Q9H4A3	0.174	0.169	8.949E-93	2382	0.360	0.348	Q9H4A3.pdb.gz	WNK1_HUMAN Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2
4	AFDB:P83741	0.160	0.155	5.105E-90	2377	0.347	0.335	P83741.pdb.gz	WNK1_MOUSE Serine/threonine-protein kinase WNK1 OS=Mus musculus OX=10090 GN=Wnk1 PE=1 SV=2
5	AFDB:F1Q6T6	0.157	0.153	7.749E-89	2357	0.335	0.327	F1Q6T6.pdb.gz
6	AFDB:Q9JIH7	0.160	0.172	1.914E-82	2126	0.327	0.353	Q9JIH7.pdb.gz	WNK1_RAT Serine/threonine-protein kinase WNK1 OS=Rattus norvegicus OX=10116 GN=Wnk1 PE=1 SV=2
7	AFDB:E7F2F9	0.163	0.223	6.056E-74	1634	0.296	0.417	E7F2F9.pdb.gz	E7F2F9_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=wnk1a PE=3 SV=2
8	AFDB:Q9BYP7	0.163	0.205	7.761E-72	1800	0.286	0.364	Q9BYP7.pdb.gz	WNK3_HUMAN Serine/threonine-protein kinase WNK3 OS=Homo sapiens OX=9606 GN=WNK3 PE=1 SV=3
9	AFDB:Q80XP9	0.177	0.226	4.054E-71	1757	0.283	0.369	Q80XP9.pdb.gz	WNK3_MOUSE Serine/threonine-protein kinase WNK3 OS=Mus musculus OX=10090 GN=Wnk3 PE=1 SV=3
10	AFDB:M9PGC5	0.164	0.154	2.054E-61	2462	0.236	0.220	M9PGC5.pdb.gz	WNK_DROME Serine/threonine-protein kinase Wnk OS=Drosophila melanogaster OX=7227 GN=Wnk PE=1 SV=2
11	PDB:4rerA	0.109	0.507	2.791E-17	459	0.035	0.176	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
12	PDB:5u6yA	0.107	0.505	4.277E-17	459	0.029	0.144	5u6yA.pdb.gz
13	PDB:5ufuA	0.106	0.615	1.117E-16	369	0.030	0.190	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
14	PDB:6b1uA	0.108	0.526	1.178E-16	442	0.034	0.174	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
15	PDB:2yaaA	0.109	0.761	1.538E-16	300	0.031	0.237	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
16	PDB:4c0tA	0.106	0.753	2.234E-16	291	0.030	0.241	4c0tA.pdb.gz
17	PDB:4krcA	0.101	0.693	2.234E-16	297	0.034	0.266	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
18	PDB:6s73A	0.102	0.795	2.234E-16	269	0.032	0.271	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
19	PDB:4zhxA	0.106	0.553	3.245E-16	409	0.030	0.171	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
20	PDB:7myjC	0.108	0.498	4.972E-16	465	0.034	0.168	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F2F9	0.0	646	1634	0.135	0.189	E7F2F9_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=wnk1a PE=3 SV=2
2	E9PCD1	0.0	4348	2217	0.962	0.997	E9PCD1_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=4
3	F5GWT4	0.0	692	2134	0.150	0.161	F5GWT4_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=1
4	H0Y7J9	0.0	1240	646	0.281	0.998	H0Y7J9_HUMAN WNK lysine deficient protein kinase 2 (Fragment) OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=1
5	H0Y7R3	0.0	3061	1773	0.687	0.891	H0Y7R3_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=1
6	H0Y7T5	0.0	4336	2220	0.960	0.994	H0Y7T5_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=1
7	P83741	0.0	690	2377	0.186	0.180	WNK1_MOUSE Serine/threonine-protein kinase WNK1 OS=Mus musculus OX=10090 GN=Wnk1 PE=1 SV=2
8	Q3UH66	0.0	1538	2149	0.357	0.382	WNK2_MOUSE Serine/threonine-protein kinase WNK2 OS=Mus musculus OX=10090 GN=Wnk2 PE=1 SV=2
9	Q80XP9	0.0	690	1757	0.151	0.197	WNK3_MOUSE Serine/threonine-protein kinase WNK3 OS=Mus musculus OX=10090 GN=Wnk3 PE=1 SV=3
10	Q9BYP7	0.0	692	1800	0.153	0.195	WNK3_HUMAN Serine/threonine-protein kinase WNK3 OS=Homo sapiens OX=9606 GN=WNK3 PE=1 SV=3
11	Q9H4A3	0.0	692	2382	0.150	0.144	WNK1_HUMAN Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2
12	Q9JIH7	0.0	697	2126	0.166	0.180	WNK1_RAT Serine/threonine-protein kinase WNK1 OS=Rattus norvegicus OX=10116 GN=Wnk1 PE=1 SV=2
13	Q9Y3S1	0.0	4550	2297	1.000	1.000	WNK2_HUMAN Serine/threonine-protein kinase WNK2 OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=4
14	X1WG08	0.0	648	1606	0.135	0.192	X1WG08_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=wnk1a PE=3 SV=1
15	Q7TPK6	2.63e-175	574	1222	0.127	0.239	WNK4_RAT Serine/threonine-protein kinase WNK4 OS=Rattus norvegicus OX=10116 GN=Wnk4 PE=1 SV=3
16	Q80UE6	3.44e-174	571	1222	0.127	0.238	WNK4_MOUSE Serine/threonine-protein kinase WNK4 OS=Mus musculus OX=10090 GN=Wnk4 PE=1 SV=1
17	Q96J92	3.33e-173	568	1243	0.114	0.212	WNK4_HUMAN Serine/threonine-protein kinase WNK4 OS=Homo sapiens OX=9606 GN=WNK4 PE=1 SV=1
18	X5M5N0	6.17e-147	507	1850	0.108	0.134	WNK_CAEEL Serine/threonine-protein kinase WNK OS=Caenorhabditis elegans OX=6239 GN=wnk-1 PE=1 SV=1
19	M9PGC5	4.03e-140	492	2462	0.104	0.097	WNK_DROME Serine/threonine-protein kinase Wnk OS=Drosophila melanogaster OX=7227 GN=Wnk PE=1 SV=2
20	Q9STK6	3.62e-84	289	516	0.074	0.331	WNK3_ARATH Probable serine/threonine-protein kinase WNK3 OS=Arabidopsis thaliana OX=3702 GN=WNK3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12202 OSR1_C	5.8e-28	108.1	Oxidative-stress-responsive kinase 1 C-terminal domain
2	PF00069 Pkinase	1.5e-49	180.4	Protein kinase domain
3	PF17667 Pkinase_fungal	1.6e+02	12.5	Fungal protein kinase
4	PF07714 PK_Tyr_Ser-Thr	1.1e-36	138.0	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297954

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353292	0.945	Amiloride-sensitive sodium channel subunit alpha
2	9606.ENSP00000300061	0.912	Amiloride-sensitive sodium channel subunit gamma
3	9606.ENSP00000368411	0.903	Amiloride-sensitive sodium channel subunit delta
4	9606.ENSP00000388107	0.902	Ubiquitin-60S ribosomal protein L40
5	9606.ENSP00000272317	0.900	Ubiquitin-40S ribosomal protein S27a
6	9606.ENSP00000304697	0.900	Polyubiquitin-B
7	9606.ENSP00000345751	0.900	Amiloride-sensitive sodium channel subunit beta
8	9606.ENSP00000441543	0.900	Polyubiquitin-C
9	9606.ENSP00000312397	0.867	Kelch-like protein 3
10	9606.ENSP00000341292	0.867	Serine/threonine-protein kinase WNK1
11	9606.ENSP00000348278	0.764	STE20/SPS1-related proline-alanine-rich protein kinase
12	9606.ENSP00000262461	0.748	Solute carrier family 12 member 2
13	9606.ENSP00000346112	0.744	Solute carrier family 12 member 6
14	9606.ENSP00000311713	0.741	Serine/threonine-protein kinase OSR1
15	9606.ENSP00000364631	0.740	FYVE, RhoGEF and PH domain-containing protein 3
16	9606.ENSP00000379822	0.714	Solute carrier family 12 member 1
17	9606.ENSP00000264938	0.693	Sodium/hydrogen exchanger 3
18	9606.ENSP00000402152	0.685	Solute carrier family 12 member 3
19	9606.ENSP00000387694	0.663	Solute carrier family 12 member 5
20	9606.ENSP00000424198	0.650	Kelch-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0019899	0.562	enzyme binding
GO:0019900	0.501	kinase binding
GO:0019901	0.368	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.983	biological regulation
GO:0006468	0.981	protein phosphorylation
GO:0050789	0.936	regulation of biological process
GO:0050794	0.924	regulation of cellular process
GO:0009966	0.885	regulation of signal transduction
GO:0042592	0.720	homeostatic process
GO:0048518	0.717	positive regulation of biological process
GO:0048878	0.666	chemical homeostasis
GO:0050801	0.659	monoatomic ion homeostasis
GO:0048522	0.603	positive regulation of cellular process
GO:0050896	0.400	response to stimulus
GO:0048519	0.379	negative regulation of biological process
GO:0051179	0.354	localization
GO:0032879	0.332	regulation of localization
GO:0065009	0.331	regulation of molecular function
GO:0051049	0.318	regulation of transport
GO:0051234	0.308	establishment of localization
GO:1902531	0.300	regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0016020	0.457	membrane
GO:0071944	0.398	cell periphery
GO:0043231	0.397	intracellular membrane-bounded organelle
GO:0005886	0.391	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]