StarFunc result for job id Q9Y3V2

User Input

>input (267 residues)
MAEPVQEELSVLAAIFCRPHEWEVLSRSETDGTVFRIHTKAEGFMDVDIPLELVFHLPVN
YPSCLPGISINSEQLTRAQCVTVKENLLEQAESLLSEPMVHELVLWIQQNLRHILSQPET
GSGSEKCTFSTSTTMDDGLWITLLHLDHMRAKTKYVKIVEKWASDLRLTGRLMFMGKIIL
ILLQGDRNNLKEYLILQKTSKVDVDSSGKKCKEKMISVLFETKVQTEHKRFLAFEVKEYS
ALDELQKEFETAGLKKLFSEFVLALVK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y3V2	1.000	1.000	1.227E-55	267	1.000	1.000	Q9Y3V2.pdb.gz	RWDD3_HUMAN RWD domain-containing protein 3 OS=Homo sapiens OX=9606 GN=RWDD3 PE=1 SV=4
2	AFDB:Q8VIL2	0.526	0.526	5.876E-48	267	0.790	0.790	Q8VIL2.pdb.gz	RWDD3_MOUSE RWD domain-containing protein 3 OS=Mus musculus OX=10090 GN=Rwdd3 PE=2 SV=1
3	AFDB:P57060	0.395	0.334	1.210E-15	319	0.202	0.169	P57060.pdb.gz	RWD2B_HUMAN RWD domain-containing protein 2B OS=Homo sapiens OX=9606 GN=RWDD2B PE=1 SV=1
4	AFDB:Q9UIY3	0.382	0.351	1.320E-13	292	0.187	0.171	Q9UIY3.pdb.gz	RWD2A_HUMAN RWD domain-containing protein 2A OS=Homo sapiens OX=9606 GN=RWDD2A PE=1 SV=1
5	PDB:6qw64A	0.407	0.449	4.285E-8	239	0.135	0.151	6qw64A.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
6	AFDB:Q09856	0.367	0.189	6.154E-8	542	0.067	0.033	Q09856.pdb.gz	PRP3_SCHPO U4/U5/U6 small nuclear ribonucleoprotein prp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp3 PE=1 SV=1
7	AFDB:Q9C7E7	0.377	0.136	2.049E-7	786	0.086	0.029	Q9C7E7.pdb.gz	RDM16_ARATH Protein RDM16 OS=Arabidopsis thaliana OX=3702 GN=RDM16 PE=2 SV=1
8	AFDB:Q9VW52	0.384	0.180	2.176E-7	598	0.079	0.035	Q9VW52.pdb.gz	Q9VW52_DROME Precursor RNA processing 3, isoform A OS=Drosophila melanogaster OX=7227 GN=Prp3 PE=1 SV=1
9	AFDB:O55091	0.345	0.293	2.940E-7	318	0.157	0.132	O55091.pdb.gz	IMPCT_MOUSE Protein IMPACT OS=Mus musculus OX=10090 GN=Impact PE=1 SV=2
10	AFDB:Q9HGN1	0.365	0.068	4.757E-7	1576	0.191	0.032	Q9HGN1.pdb.gz	GCN2_SCHPO eIF-2-alpha kinase GCN2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn2 PE=2 SV=2
11	AFDB:O43395	0.371	0.153	7.248E-7	683	0.101	0.040	O43395.pdb.gz	PRPF3_HUMAN U4/U6 small nuclear ribonucleoprotein Prp3 OS=Homo sapiens OX=9606 GN=PRPF3 PE=1 SV=2
12	PDB:6ah0J	0.345	0.529	2.270E-6	167	0.101	0.162	6ah0J.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
13	PDB:5nrlG	0.372	0.277	2.232E-5	372	0.082	0.059	5nrlG.pdb.gz	Structure of a pre-catalytic spliceosome.
14	PDB:6ahdJ	0.348	0.404	3.202E-5	227	0.075	0.088	6ahdJ.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
15	PDB:5ganG	0.339	0.289	1.132E-4	318	0.094	0.079	5ganG.pdb.gz	Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
16	PDB:3toqA	0.304	0.774	1.277E-4	95	0.052	0.147	3toqA.pdb.gz
17	PDB:2hfoA	0.326	0.533	1.530E-4	150	0.045	0.080	2hfoA.pdb.gz	Crystal structures of the Synechocystis photoreceptor Slr1694 reveal distinct structural states related to signaling.
18	PDB:2gv1A	0.286	0.726	2.067E-4	92	0.034	0.098	2gv1A.pdb.gz
19	PDB:1urrA	0.318	0.796	2.331E-4	97	0.052	0.144	1urrA.pdb.gz
20	PDB:2k7jA	0.309	0.745	1.416E-3	99	0.045	0.121	2k7jA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y3V2	0.0	548	267	1.000	1.000	RWDD3_HUMAN RWD domain-containing protein 3 OS=Homo sapiens OX=9606 GN=RWDD3 PE=1 SV=4
2	Q8VIL2	2.23e-153	430	267	0.790	0.790	RWDD3_MOUSE RWD domain-containing protein 3 OS=Mus musculus OX=10090 GN=Rwdd3 PE=2 SV=1
3	Q4WU06	5.55e-04	43.5	1592	0.109	0.018	Q4WU06_ASPFU non-specific serine/threonine protein kinase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_5G06750 PE=4 SV=1
4	P57060	0.091	36.2	319	0.146	0.122	RWD2B_HUMAN RWD domain-containing protein 2B OS=Homo sapiens OX=9606 GN=RWDD2B PE=1 SV=1
5	Q06698	0.90	33.5	1435	0.060	0.011	YL419_YEAST Putative ATP-dependent RNA helicase YLR419W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLR419W PE=1 SV=1
6	Q06850	3.1	31.6	610	0.097	0.043	CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana OX=3702 GN=CPK1 PE=1 SV=1
7	Q9D071	3.1	32.0	1031	0.094	0.024	MMS19_MOUSE MMS19 nucleotide excision repair protein homolog OS=Mus musculus OX=10090 GN=Mms19 PE=1 SV=1
8	P39406	3.2	31.6	343	0.056	0.044	RSMC_ECOLI Ribosomal RNA small subunit methyltransferase C OS=Escherichia coli (strain K12) OX=83333 GN=rsmC PE=1 SV=3
9	Q38870	8.4	30.4	646	0.101	0.042	CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana OX=3702 GN=CPK2 PE=1 SV=1
10	F4J8A5	9.5	30.4	1265	0.109	0.023	F4J8A5_ARATH non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=GCN2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06544 DUF1115	0.32	22.5	Protein of unknown function (DUF1115)
2	PF05773 RWD	1.9e-12	58.9	RWD domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359221

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348056	0.993	SUMO-conjugating enzyme UBC9
2	9606.ENSP00000376077	0.959	Small ubiquitin-related modifier 1
3	9606.ENSP00000270225	0.926	SUMO-activating enzyme subunit 1
4	9606.ENSP00000246548	0.922	SUMO-activating enzyme subunit 2
5	9606.ENSP00000475025	0.715	TMEM56-RWDD3 readthrough
6	9606.ENSP00000437955	0.680	Hypoxia-inducible factor 1-alpha
7	9606.ENSP00000359222	0.581	Transmembrane protein 56
8	9606.ENSP00000256474	0.547	Von Hippel-Lindau disease tumor suppressor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.424	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048522	0.988	positive regulation of cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0051246	0.978	regulation of protein metabolic process
GO:0051173	0.971	positive regulation of nitrogen compound metabolic process
GO:0010604	0.970	positive regulation of macromolecule metabolic process
GO:0031323	0.959	regulation of cellular metabolic process
GO:0006355	0.916	regulation of DNA-templated transcription
GO:0051247	0.911	positive regulation of protein metabolic process
GO:0048583	0.891	regulation of response to stimulus
GO:0010646	0.859	regulation of cell communication
GO:0023051	0.858	regulation of signaling
GO:0009966	0.827	regulation of signal transduction
GO:0048584	0.823	positive regulation of response to stimulus
GO:0023056	0.818	positive regulation of signaling
GO:1903320	0.815	regulation of protein modification by small protein conjugation or removal
GO:0010647	0.813	positive regulation of cell communication
GO:0065009	0.768	regulation of molecular function
GO:0009967	0.727	positive regulation of signal transduction
GO:1903322	0.698	positive regulation of protein modification by small protein conjugation or removal
GO:0043433	0.498	negative regulation of DNA-binding transcription factor activity
GO:0033233	0.312	regulation of protein sumoylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.985	cytosol
GO:0032991	0.960	protein-containing complex
GO:0043226	0.902	organelle
GO:0043231	0.888	intracellular membrane-bounded organelle
GO:0005634	0.883	nucleus
GO:0070013	0.543	intracellular organelle lumen
GO:0031981	0.530	nuclear lumen
GO:0005654	0.447	nucleoplasm
GO:0016020	0.363	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]