StarFunc result for job id Q9Y3Y2

User Input

>input (248 residues)
MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPTPVNIRASMQQQQQLASARNRRLAQQME
NRPSVQAALKLKQSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGG
RATRTLLRGGMSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGR
GRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMA
QTDPETND

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9CY57	0.317	0.316	1.631E-30	249	0.992	0.988	Q9CY57.pdb.gz	CHTOP_MOUSE Chromatin target of PRMT1 protein OS=Mus musculus OX=10090 GN=Chtop PE=1 SV=2
2	AFDB:Q2L6I2	0.132	0.046	3.576E-1	807	0.141	0.043	Q2L6I2.pdb.gz	Q2L6I2_HUMAN ABC50 protein OS=Homo sapiens OX=9606 GN=ABCF1 PE=4 SV=1
3	AFDB:E1JIT7	0.131	0.025	3.825E-1	1601	0.202	0.031	E1JIT7.pdb.gz	PSD_DROME PH and SEC7 domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Efa6 PE=1 SV=2
4	AFDB:Q6FRZ8	0.117	0.059	4.377E-1	588	0.129	0.054	Q6FRZ8.pdb.gz	AP1_CANGA bZip transcription factor GAP1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=AP1 PE=3 SV=1
5	AFDB:B3GWA1	0.144	0.071	1.203	562	0.246	0.109	B3GWA1.pdb.gz	B3GWA1_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nono-1 PE=1 SV=1
6	AFDB:C8V9H0	0.177	0.131	1.473	400	0.181	0.113	C8V9H0.pdb.gz	C8V9H0_EMENI MEAB protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04900 PE=4 SV=1
7	AFDB:P40473	0.109	0.085	2.064	351	0.153	0.108	P40473.pdb.gz	POG1_YEAST Transcriptional activator POG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=POG1 PE=1 SV=1
8	AFDB:Q0KIC3	0.119	0.034	2.064	1372	0.137	0.025	Q0KIC3.pdb.gz	Y3427_DROME Uncharacterized protein CG43427 OS=Drosophila melanogaster OX=7227 GN=CG43427 PE=2 SV=1
9	AFDB:P53289	0.093	0.088	2.208	263	0.141	0.133	P53289.pdb.gz	RTS3_YEAST Protein phosphatase type 2A regulatory subunit RTS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTS3 PE=1 SV=1
10	AFDB:Q389J7	0.167	0.145	2.208	306	0.145	0.118	Q389J7.pdb.gz	Q389J7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0520 PE=4 SV=1
11	PDB:7nacI	0.092	0.049	5.405	533	0.056	0.026	7nacI.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
12	PDB:6rw4Y	0.086	0.102	8.665	149	0.040	0.067	6rw4Y.pdb.gz	Distinct pre-initiation steps in human mitochondrial translation.
13	PDB:6ud7D	0.086	0.225	9.915	73	0.020	0.068	6ud7D.pdb.gz	Structural basis of indisulam-mediated RBM39 recruitment to DCAF15 E3 ligase complex.
14	PDB:7v2wJ	0.115	0.120	9.915	236	0.073	0.076	7v2wJ.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y3Y2	9.20e-169	467	248	1.000	1.000	CHTOP_HUMAN Chromatin target of PRMT1 protein OS=Homo sapiens OX=9606 GN=CHTOP PE=1 SV=2
2	Q9CY57	1.16e-165	459	249	0.992	0.988	CHTOP_MOUSE Chromatin target of PRMT1 protein OS=Mus musculus OX=10090 GN=Chtop PE=1 SV=2
3	X6R700	2.25e-148	414	223	0.899	1.000	X6R700_HUMAN Chromatin target of PRMT1 OS=Homo sapiens OX=9606 GN=CHTOP PE=1 SV=1
4	P35207	0.008	39.7	1287	0.101	0.019	SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKI2 PE=1 SV=2
5	A5PJP2	0.19	35.4	903	0.125	0.034	A5PJP2_BOVIN SAFB protein OS=Bos taurus OX=9913 GN=SAFB PE=2 SV=1
6	Q6FPN0	0.83	33.5	870	0.081	0.023	AWP1_CANGA Adhesin AWP1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=AWP1 PE=1 SV=1
7	Q8T8Q5	1.5	32.7	1489	0.073	0.012	Q8T8Q5_DROME SD05887p OS=Drosophila melanogaster OX=7227 GN=Golgin245 PE=2 SV=1
8	Q9W1R3	1.5	32.7	1489	0.073	0.012	Q9W1R3_DROME Golgin-245 OS=Drosophila melanogaster OX=7227 GN=Golgin245 PE=1 SV=2
9	Q6MWX9	9.1	30.0	3157	0.157	0.012	Q6MWX9_MYCTU PPE family protein PPE55 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=PPE55 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13865 FoP_duplication	1.3e-19	81.9	C-terminal duplication domain of Friend of PRMT1
2	PF11621 Sbi-IV	7.5e+02	11.9	C3 binding domain 4 of IgG-bind protein SBI

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000002284

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000054521	0.987	Involved in nuclear export of spliced and unspliced mRNA. Assembling component of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway. May undergo several rounds [...]
2	9598.ENSPTRP00000008618	0.927	SAP domain containing ribonucleoprotein
3	9598.ENSPTRP00000040232	0.911	THO complex 5
4	9598.ENSPTRP00000010989	0.879	Enhancer of rudimentary homolog
5	9598.ENSPTRP00000018068	0.872	DExD-box helicase 39A
6	9598.ENSPTRP00000038301	0.870	THO complex 2
7	9598.ENSPTRP00000016036	0.864	Pan troglodytes serine/arginine-rich splicing factor 1 (SRSF1), mRNA
8	9598.ENSPTRP00000006511	0.858	Nuclear RNA export factor 1
9	9598.ENSPTRP00000016706	0.858	Uncharacterized protein
10	9598.ENSPTRP00000027177	0.858	Forty-two-three domain containing 1
11	9598.ENSPTRP00000026034	0.857	THO complex 7 homolog (Drosophila)
12	9598.ENSPTRP00000024908	0.853	Polymerase (DNA-directed), delta interacting protein 3
13	9598.ENSPTRP00000016638	0.837	Uncharacterized protein
14	9598.ENSPTRP00000000569	0.817	Heterogeneous nuclear ribonucleoprotein R
15	9598.ENSPTRP00000018758	0.807	Heterogeneous nuclear ribonucleoprotein L
16	9598.ENSPTRP00000013118	0.788	THO complex 6 homolog
17	9598.ENSPTRP00000029570	0.784	Matrin 3
18	9598.ENSPTRP00000017713	0.773	ELAV-like protein
19	9598.ENSPTRP00000032472	0.770	Heterogeneous nuclear ribonucleoprotein A2/B1
20	9598.ENSPTRP00000045804	0.760	THO complex 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0097159	0.912	organic cyclic compound binding
GO:1901363	0.909	heterocyclic compound binding
GO:0003676	0.837	nucleic acid binding
GO:0003723	0.689	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051649	0.989	establishment of localization in cell
GO:0010467	0.987	gene expression
GO:0033036	0.986	macromolecule localization
GO:0071705	0.986	nitrogen compound transport
GO:0071702	0.986	organic substance transport
GO:0006406	0.977	mRNA export from nucleus
GO:0051171	0.968	regulation of nitrogen compound metabolic process
GO:0080090	0.967	regulation of primary metabolic process
GO:0060255	0.967	regulation of macromolecule metabolic process
GO:0031323	0.964	regulation of cellular metabolic process
GO:0048518	0.942	positive regulation of biological process
GO:0032501	0.940	multicellular organismal process
GO:0051246	0.865	regulation of protein metabolic process
GO:0048522	0.845	positive regulation of cellular process
GO:0051173	0.786	positive regulation of nitrogen compound metabolic process
GO:0010604	0.785	positive regulation of macromolecule metabolic process
GO:0031056	0.739	regulation of histone modification
GO:0031325	0.734	positive regulation of cellular metabolic process
GO:0043462	0.708	regulation of ATP-dependent activity
GO:0031060	0.700	regulation of histone methylation
GO:0031058	0.645	positive regulation of histone modification
GO:0032502	0.634	developmental process
GO:0031062	0.587	positive regulation of histone methylation
GO:0048856	0.408	anatomical structure development
GO:0007275	0.396	multicellular organism development
GO:0044237	0.334	cellular metabolic process
GO:0044238	0.333	primary metabolic process
GO:0006807	0.333	nitrogen compound metabolic process
GO:0010468	0.321	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0036464	1.000	cytoplasmic ribonucleoprotein granule
GO:0016607	1.000	nuclear speck
GO:0032991	0.995	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]