StarFunc result for job id Q9Y3Y4

User Input

>input (419 residues)
MPAENSPAPAYKVSSHGGDSGLDGLGGPGVQLGSPDKKKRKANTQGPSFPPLSEYAPPPN
PNSDHLVAANPFDDNYNTISYKPLPSSNPYLGPGYPGFGGYSTFRMPPHVPPRMSSPYCG
PYSLRNQPHPFPQNPLGMGFNRPHAFNFGPHDNSSFGNPSYNNALSQNVNMPNQHFRQNP
AENFSQIPPQNASQVSNPDLASNFVPGNNSNFTSPLESNHSFIPPPNTFGQAKAPPPKQD
FTQGATKNTNQNSSAHPPHLNMDDTVNQSNIELKNVNRNNAVNQENSRSSSTEATNNNPA
NGTQNKPRQPRGAADACTTEKSNKSSLHPNRHGHSSSDPVYPCGICTNEVNDDQDAILCE
ASCQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMADKDVQLMRTRETFGPSAVGSDA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y3Y4	0.999	0.999	4.624E-63	419	1.000	1.000	Q9Y3Y4.pdb.gz	PYGO1_HUMAN Pygopus homolog 1 OS=Homo sapiens OX=9606 GN=PYGO1 PE=1 SV=2
2	AFDB:Q9D0P5	0.325	0.326	6.534E-54	417	0.874	0.878	Q9D0P5.pdb.gz	PYGO1_MOUSE Pygopus homolog 1 OS=Mus musculus OX=10090 GN=Pygo1 PE=1 SV=1
3	AFDB:Q9BRQ0	0.178	0.183	1.211E-18	406	0.368	0.379	Q9BRQ0.pdb.gz	PYGO2_HUMAN Pygopus homolog 2 OS=Homo sapiens OX=9606 GN=PYGO2 PE=1 SV=2
4	AFDB:Q1L8T6	0.161	0.120	6.836E-12	571	0.365	0.268	Q1L8T6.pdb.gz	Q1L8T6_DANRE Pygopus homolog 2 OS=Danio rerio OX=7955 GN=wu:fc46c10 PE=1 SV=1
5	PDB:5z8lA	0.109	0.214	1.396E-2	204	0.041	0.083	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
6	AFDB:B0JZI5	0.068	0.053	7.996E-2	561	0.212	0.159	B0JZI5.pdb.gz
7	AFDB:Q14202	0.082	0.033	2.549E-1	1370	0.131	0.040	Q14202.pdb.gz	ZMYM3_HUMAN Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=2
8	AFDB:Q9V4D4	0.124	0.041	2.728E-1	1406	0.186	0.055	Q9V4D4.pdb.gz	Q9V4D4_DROME Bip2 OS=Drosophila melanogaster OX=7227 GN=Taf3 PE=1 SV=1
9	PDB:1b8tA	0.097	0.189	4.518E-1	192	0.048	0.104	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
10	PDB:2lgvA	0.072	0.257	6.802E-1	100	0.038	0.160	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
11	AFDB:Q80V63	0.071	0.041	7.587E-1	803	0.138	0.072	Q80V63.pdb.gz	PRDM4_MOUSE PR domain zinc finger protein 4 OS=Mus musculus OX=10090 GN=Prdm4 PE=2 SV=2
12	AFDB:Q555I8	0.087	0.038	9.310E-1	1222	0.153	0.052	Q555I8.pdb.gz	KIF9_DICDI Kinesin-related protein 9 OS=Dictyostelium discoideum OX=44689 GN=kif9 PE=2 SV=1
13	PDB:7uhyD	0.072	0.092	9.566E-1	288	0.041	0.059	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
14	AFDB:B1AY10	0.087	0.035	1.309	1114	0.143	0.054	B1AY10.pdb.gz	NFX1_MOUSE Transcriptional repressor NF-X1 OS=Mus musculus OX=10090 GN=Nfx1 PE=1 SV=1
15	PDB:6ft6u	0.073	0.162	1.345	150	0.021	0.060	6ft6u.pdb.gz	Structure of the nuclear exosome captured on a maturing preribosome.
16	PDB:4kfzB	0.069	0.178	1.767	148	0.021	0.061	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
17	PDB:7ls2Q2	0.069	0.214	2.025	110	0.010	0.036	7ls2Q2.pdb.gz	Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.
18	PDB:6ip52Q	0.073	0.222	2.321	124	0.029	0.097	6ip52Q.pdb.gz	HCV IRES Captures an Actively Translating 80S Ribosome.
19	PDB:6lss7	0.066	0.163	2.321	135	0.012	0.037	6lss7.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
20	PDB:4v8mBY	0.077	0.230	3.049	100	0.019	0.080	4v8mBY.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9D0P5	0.0	688	417	0.838	0.842	PYGO1_MOUSE Pygopus homolog 1 OS=Mus musculus OX=10090 GN=Pygo1 PE=1 SV=1
2	Q9Y3Y4	0.0	855	419	1.000	1.000	PYGO1_HUMAN Pygopus homolog 1 OS=Homo sapiens OX=9606 GN=PYGO1 PE=1 SV=2
3	A8WG61	1.68e-85	266	337	0.415	0.516	A8WG61_DANRE Pygopus homolog 1 OS=Danio rerio OX=7955 GN=pygo1 PE=2 SV=1
4	Q3V113	2.18e-33	130	368	0.129	0.147	Q3V113_MOUSE Pygopus 2 OS=Mus musculus OX=10090 GN=Pygo2 PE=1 SV=1
5	Q9BRQ0	2.27e-33	131	406	0.129	0.133	PYGO2_HUMAN Pygopus homolog 2 OS=Homo sapiens OX=9606 GN=PYGO2 PE=1 SV=2
6	Q80V76	2.78e-33	131	405	0.129	0.133	Q80V76_MOUSE Pygopus 2 OS=Mus musculus OX=10090 GN=Pygo2 PE=1 SV=1
7	Q1L8T6	1.10e-29	123	571	0.110	0.081	Q1L8T6_DANRE Pygopus homolog 2 OS=Danio rerio OX=7955 GN=wu:fc46c10 PE=1 SV=1
8	Q9V9W8	3.18e-18	89.4	815	0.072	0.037	PYGO_DROME Protein pygopus OS=Drosophila melanogaster OX=7227 GN=pygo PE=1 SV=1
9	A0A3B3ITA8	0.034	38.9	1499	0.031	0.009	A0A3B3ITA8_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
10	A0A3B3IS40	0.037	38.9	1539	0.031	0.008	A0A3B3IS40_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
11	Q9UGL1	0.037	38.9	1544	0.031	0.008	KDM5B_HUMAN Lysine-specific demethylase 5B OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=3
12	A0A3B3ITJ7	0.040	38.9	1503	0.031	0.009	A0A3B3ITJ7_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
13	Q80Y84	0.041	38.9	1544	0.031	0.008	KDM5B_MOUSE Lysine-specific demethylase 5B OS=Mus musculus OX=10090 GN=Kdm5b PE=1 SV=1
14	A0A0G2K3N6	0.042	38.9	1544	0.031	0.008	A0A0G2K3N6_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5b PE=3 SV=2
15	Q9V4D4	0.060	38.1	1406	0.043	0.013	Q9V4D4_DROME Bip2 OS=Drosophila melanogaster OX=7227 GN=Taf3 PE=1 SV=1
16	Q23541	0.12	37.4	1477	0.031	0.009	KDM5_CAEEL Lysine-specific demethylase rbr-2 OS=Caenorhabditis elegans OX=6239 GN=rbr-2 PE=1 SV=2
17	Q9U1I0	0.19	36.6	1406	0.041	0.012	Q9U1I0_DROME BIP2 protein OS=Drosophila melanogaster OX=7227 GN=Taf3 PE=4 SV=1
18	Q9XZU7	0.19	36.6	1408	0.041	0.012	Q9XZU7_DROME Bip2 protein OS=Drosophila melanogaster OX=7227 GN=Taf3 PE=2 SV=1
19	F4JTS8	0.20	36.6	2729	0.112	0.017	NOV_ARATH Protein NO VEIN OS=Arabidopsis thaliana OX=3702 GN=NOV PE=1 SV=1
20	Q8T9I5	0.22	36.2	363	0.045	0.052	Q8T9I5_DROME GM10839p OS=Drosophila melanogaster OX=7227 GN=Taf3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00628 PHD	0.0013	29.9	PHD-finger
2	PF14446 Prok-RING_1	8	17.8	Prokaryotic RING finger family 1
3	PF17123 zf-RING_11	1.7e+02	13.4	RING-like zinc finger
4	PF13639 zf-RING_2	53	15.6	Ring finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302327

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000234739	0.999	B-cell CLL/lymphoma 9 protein
2	9606.ENSP00000355657	0.979	Histone H3.1t
3	9606.ENSP00000332194	0.902	Histone H2A type 2-C
4	9606.ENSP00000434024	0.902	Histone H2AX
5	9606.ENSP00000438553	0.902	Histone H2A.J
6	9606.ENSP00000296417	0.901	Histone H2A.Z
7	9606.ENSP00000308405	0.901	Histone H2A.V
8	9606.ENSP00000274764	0.900	Histone H2B type 1-A
9	9606.ENSP00000289316	0.900	Histone H2B type 1-D
10	9606.ENSP00000328484	0.900	Histone H2A type 1-J
11	9606.ENSP00000341094	0.900	Histone H2A type 1-D
12	9606.ENSP00000349430	0.900	Histone H2B type 1-K
13	9606.ENSP00000358151	0.900	Histone H2B type 2-E
14	9606.ENSP00000366618	0.900	Histone H2B type 1-L
15	9606.ENSP00000367022	0.900	Histone H2A type 1-C
16	9606.ENSP00000476136	0.900	Histone H2B type 1-J
17	9606.ENSP00000477527	0.900	Histone H2B type 1-O
18	9606.ENSP00000477907	0.900	Histone H2B type 1-M
19	9606.ENSP00000479169	0.900	Histone H2B type 1-H
20	9606.ENSP00000481622	0.900	Histone H2B type F-S

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035064	0.998	methylated histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0009987	0.992	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0019222	0.983	regulation of metabolic process
GO:0051171	0.973	regulation of nitrogen compound metabolic process
GO:0031323	0.965	regulation of cellular metabolic process
GO:0048856	0.950	anatomical structure development
GO:0050896	0.947	response to stimulus
GO:0060255	0.942	regulation of macromolecule metabolic process
GO:0032501	0.939	multicellular organismal process
GO:0080090	0.919	regulation of primary metabolic process
GO:0048518	0.907	positive regulation of biological process
GO:0048731	0.905	system development
GO:0048513	0.903	animal organ development
GO:0019219	0.896	regulation of nucleobase-containing compound metabolic process
GO:0010604	0.895	positive regulation of macromolecule metabolic process
GO:0010468	0.893	regulation of gene expression
GO:0051252	0.882	regulation of RNA metabolic process
GO:0051716	0.875	cellular response to stimulus
GO:0051173	0.874	positive regulation of nitrogen compound metabolic process
GO:0006355	0.867	regulation of DNA-templated transcription
GO:0071840	0.865	cellular component organization or biogenesis
GO:0016043	0.857	cellular component organization
GO:0048522	0.852	positive regulation of cellular process
GO:0000003	0.796	reproduction
GO:0006357	0.781	regulation of transcription by RNA polymerase II
GO:0023052	0.776	signaling
GO:0007154	0.776	cell communication
GO:0007165	0.762	signal transduction
GO:0045944	0.731	positive regulation of transcription by RNA polymerase II
GO:0022414	0.591	reproductive process
GO:0003006	0.434	developmental process involved in reproduction
GO:0007166	0.351	cell surface receptor signaling pathway
GO:0030154	0.338	cell differentiation
GO:0007267	0.338	cell-cell signaling
GO:0006996	0.330	organelle organization
GO:0048468	0.326	cell development
GO:0016055	0.308	Wnt signaling pathway
GO:0007276	0.305	gamete generation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.534	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]