StarFunc result for job id Q9Y3Z3

User Input

>input (626 residues)
MQRADSEQPSKRPRCDDSPRTPSNTPSAEADWSPGLELHPDYKTWGPEQVCSFLRRGGFE
EPVLLKNIRENEITGALLPCLDESRFENLGVSSLGERKKLLSYIQRLVQIHVDTMKVIND
PIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVH
ALGEKQPELQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMM
FEHLINSNGIKPVMEQYGLIPEEDICFIKEQIVGPLESPVEDSLWPYKGRPENKSFLYEI
VSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFARVCEVDNELRICARDKEVGNLY
DMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAYT
KLTDNIFLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEV
ASAKPKVLLDVKLKAEDFIVDVINMDYGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQL
LPEKFAEQLIRVYCKKVDRKSLYAARQYFVQWCADRNFTKPQDGDVIAPLITPQKKEWND
STSVQNPTRLREASKSRVQLFKDDPM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y3Z3	1.000	1.000	6.290E-100	626	1.000	1.000	Q9Y3Z3.pdb.gz	SAMH1_HUMAN Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1 PE=1 SV=2
2	AFDB:A0A023VTS2	0.832	0.831	3.466E-85	627	0.804	0.802	A0A023VTS2.pdb.gz	A0A023VTS2_PIG Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Sus scrofa OX=9823 GN=SAMHD1 PE=2 SV=1
3	AFDB:Q60710	0.790	0.753	6.015E-77	658	0.724	0.688	Q60710.pdb.gz	SAMH1_MOUSE Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Mus musculus OX=10090 GN=Samhd1 PE=1 SV=3
4	AFDB:Q6INN8	0.814	0.807	3.224E-73	632	0.623	0.617	Q6INN8.pdb.gz	SAMH1_XENLA Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Xenopus laevis OX=8355 GN=samhd1 PE=1 SV=2
5	PDB:7ujnA	0.772	0.991	2.726E-70	487	0.778	1.000	7ujnA.pdb.gz	Phosphorylation of SAMHD1 Thr592 increases C-terminal domain dynamics, tetramer dissociation and ssDNA binding kinetics.
6	AFDB:Q502K2	0.786	0.791	1.978E-69	622	0.589	0.593	Q502K2.pdb.gz	SAMH1_DANRE Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Danio rerio OX=7955 GN=samhd1 PE=2 SV=2
7	PDB:6brhB	0.681	0.844	5.753E-59	502	0.615	0.767	6brhB.pdb.gz	The SAM domain of mouse SAMHD1 is critical for its activation and regulation.
8	AFDB:Q583P4	0.674	0.577	6.610E-36	735	0.275	0.234	Q583P4.pdb.gz	Q583P4_TRYB2 HD domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.540 PE=4 SV=1
9	AFDB:Q9FL05	0.646	0.850	3.302E-34	473	0.260	0.345	Q9FL05.pdb.gz	Q9FL05_ARATH AT5g40270/MSN9_170 OS=Arabidopsis thaliana OX=3702 GN=VEN4 PE=1 SV=1
10	AFDB:Q57X97	0.636	0.858	1.236E-30	458	0.204	0.279	Q57X97.pdb.gz	Q57X97_TRYB2 HD domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.320 PE=4 SV=1
11	AFDB:Q727L7	0.542	0.742	9.181E-19	445	0.141	0.198	Q727L7.pdb.gz	Q727L7_DESVH HD/PDEase domain-containing protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2838 PE=1 SV=1
12	PDB:6oiwA	0.138	0.167	1.418E-3	504	0.094	0.117	6oiwA.pdb.gz	The crystal structure of dGTPase reveals the molecular basis of dGTP selectivity.
13	PDB:7u65A	0.162	0.201	1.942E-3	481	0.109	0.141	7u65A.pdb.gz
14	AFDB:G3V9H6	0.105	0.077	8.214E-3	876	0.080	0.057	G3V9H6.pdb.gz	G3V9H6_RAT PPFIA binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ppfibp2 PE=1 SV=2
15	PDB:3bs5A	0.100	0.653	1.215E-1	86	0.022	0.163	3bs5A.pdb.gz
16	PDB:6mzbB	0.151	0.123	6.705E-1	807	0.070	0.055	6mzbB.pdb.gz	Cryo-EM structure of phosphodiesterase 6 reveals insights into the allosteric regulation of type I phosphodiesterases.
17	PDB:3spaA	0.107	0.086	8.396E-1	941	0.083	0.055	3spaA.pdb.gz	Structure of human mitochondrial RNA polymerase
18	PDB:4a0cA	0.090	0.064	8.782E-1	1155	0.081	0.044	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
19	PDB:1u6zB	0.175	0.210	9.608E-1	500	0.053	0.066	1u6zB.pdb.gz
20	PDB:1q8kA	0.080	0.132	1.203	300	0.043	0.090	1q8kA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A023VTS2	0.0	1027	627	0.805	0.804	A0A023VTS2_PIG Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Sus scrofa OX=9823 GN=SAMHD1 PE=2 SV=1
2	A0A2R8YCS7	0.0	1216	589	0.930	0.988	A0A2R8YCS7_HUMAN Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1 PE=1 SV=1
3	Q502K2	0.0	760	622	0.583	0.587	SAMH1_DANRE Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Danio rerio OX=7955 GN=samhd1 PE=2 SV=2
4	Q60710	0.0	917	658	0.730	0.695	SAMH1_MOUSE Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Mus musculus OX=10090 GN=Samhd1 PE=1 SV=3
5	Q6INN8	0.0	785	632	0.618	0.612	SAMH1_XENLA Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Xenopus laevis OX=8355 GN=samhd1 PE=1 SV=2
6	Q9Y3Z3	0.0	1306	626	1.000	1.000	SAMH1_HUMAN Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1 PE=1 SV=2
7	Q9FL05	7.21e-84	273	473	0.265	0.351	Q9FL05_ARATH AT5g40270/MSN9_170 OS=Arabidopsis thaliana OX=3702 GN=VEN4 PE=1 SV=1
8	Q583P4	1.23e-80	271	735	0.273	0.233	Q583P4_TRYB2 HD domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.540 PE=4 SV=1
9	Q57X97	5.96e-58	203	458	0.220	0.301	Q57X97_TRYB2 HD domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.320 PE=4 SV=1
10	Q727L7	5.50e-17	86.3	445	0.109	0.153	Q727L7_DESVH HD/PDEase domain-containing protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2838 PE=1 SV=1
11	O74653	0.003	43.1	871	0.037	0.026	POB1_SCHPO Protein pob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pob1 PE=1 SV=1
12	O31774	0.024	40.0	520	0.046	0.056	RNY_BACSU Ribonuclease Y OS=Bacillus subtilis (strain 168) OX=224308 GN=rny PE=1 SV=1
13	P18160	0.040	39.7	2410	0.035	0.009	SPLA_DICDI Dual specificity protein kinase splA OS=Dictyostelium discoideum OX=44689 GN=splA PE=1 SV=3
14	O75445	0.22	37.4	5202	0.021	0.002	USH2A_HUMAN Usherin OS=Homo sapiens OX=9606 GN=USH2A PE=1 SV=3
15	Q8N6K7	0.28	36.6	520	0.035	0.042	SAMD3_HUMAN Sterile alpha motif domain-containing protein 3 OS=Homo sapiens OX=9606 GN=SAMD3 PE=1 SV=2
16	P36622	0.94	34.7	264	0.029	0.068	STE4_SCHPO Sexual differentiation protein ste4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ste4 PE=2 SV=1
17	P15723	1.3	34.7	505	0.043	0.053	DGTP_ECOLI Deoxyguanosinetriphosphate triphosphohydrolase OS=Escherichia coli (strain K12) OX=83333 GN=dgt PE=1 SV=4
18	A0A509ANR4	1.7	34.3	793	0.027	0.021	A0A509ANR4_PLABA Phosphodiesterase OS=Plasmodium berghei (strain Anka) OX=5823 GN=PBANKA_1333700 PE=3 SV=1
19	P9WNY7	1.8	33.9	431	0.029	0.042	DGTL1_MYCTU Deoxyguanosinetriphosphate triphosphohydrolase-like protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=dgt PE=1 SV=1
20	Q8I5V4	1.9	34.3	954	0.029	0.019	PDEA_PLAF7 cGMP-specific 3',5'-cyclic phosphodiesterase alpha OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PDEalpha PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01966 HD	6.4e-15	66.9	HD domain
2	PF19276 HD_assoc_2	91	13.8	HD associated region
3	PF00233 PDEase_I	47	15.1	3'5'-cyclic nucleotide phosphodiesterase
4	PF00536 SAM_1	4.1e-06	38.5	SAM domain (Sterile alpha motif)
5	PF07647 SAM_2	8.8e-07	40.3	SAM domain (Sterile alpha motif)
6	PF09235 SAM_Ste50p	1.4e+02	14.2	Ste50p, sterile alpha motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262878

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000393183	0.997	DDB1- and CUL4-associated factor 1
2	9606.ENSP00000252593	0.981	Bone marrow stromal antigen 2
3	9606.ENSP00000333657	0.972	Interferon-induced GTP-binding protein Mx2
4	9606.ENSP00000357459	0.971	Double-stranded RNA-specific adenosine deaminase
5	9606.ENSP00000380697	0.962	Interferon regulatory factor 7
6	9606.ENSP00000274026	0.961	Cyclin-A2
7	9606.ENSP00000471896	0.959	Interferon regulatory factor 3
8	9606.ENSP00000381601	0.955	Interferon-induced GTP-binding protein Mx1
9	9606.ENSP00000368699	0.953	Ubiquitin-like protein ISG15
10	9606.ENSP00000371471	0.953	Radical S-adenosyl methionine domain-containing protein 2
11	9606.ENSP00000356530	0.947	2-5A-dependent ribonuclease
12	9606.ENSP00000360869	0.947	Interferon-induced protein with tetratricopeptide repeats 1
13	9606.ENSP00000382707	0.947	Interferon-induced transmembrane protein 3
14	9606.ENSP00000354394	0.945	Signal transducer and activator of transcription 1-alpha/beta
15	9606.ENSP00000360883	0.939	Interferon-induced protein with tetratricopeptide repeats 3
16	9606.ENSP00000360891	0.939	Interferon-induced protein with tetratricopeptide repeats 2
17	9606.ENSP00000386187	0.939	Interferon-induced transmembrane protein 1
18	9606.ENSP00000388001	0.938	2'-5'-oligoadenylate synthase 1
19	9606.ENSP00000342278	0.936	2'-5'-oligoadenylate synthase 2
20	9606.ENSP00000245414	0.934	Interferon regulatory factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0042578	0.999	phosphoric ester hydrolase activity
GO:0008832	0.993	dGTPase activity
GO:0097159	0.984	organic cyclic compound binding
GO:1901363	0.980	heterocyclic compound binding
GO:0003676	0.968	nucleic acid binding
GO:0042802	0.925	identical protein binding
GO:0097367	0.887	carbohydrate derivative binding
GO:0043167	0.880	ion binding
GO:0046872	0.860	metal ion binding
GO:0017076	0.858	purine nucleotide binding
GO:0003677	0.764	DNA binding
GO:0046914	0.695	transition metal ion binding
GO:0140640	0.678	catalytic activity, acting on a nucleic acid
GO:0140098	0.664	catalytic activity, acting on RNA
GO:0032552	0.617	deoxyribonucleotide binding
GO:0032567	0.606	dGTP binding
GO:0003723	0.514	RNA binding
GO:0003697	0.507	single-stranded DNA binding
GO:0004540	0.447	ribonuclease activity
GO:0008270	0.421	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.994	regulation of biological process
GO:0009987	0.986	cellular process
GO:0071704	0.985	organic substance metabolic process
GO:0050794	0.984	regulation of cellular process
GO:0044238	0.972	primary metabolic process
GO:0048519	0.970	negative regulation of biological process
GO:0050896	0.959	response to stimulus
GO:0043170	0.957	macromolecule metabolic process
GO:0044419	0.941	biological process involved in interspecies interaction between organisms
GO:0060759	0.934	regulation of response to cytokine stimulus
GO:0009966	0.923	regulation of signal transduction
GO:0044237	0.849	cellular metabolic process
GO:0045088	0.846	regulation of innate immune response
GO:0006807	0.835	nitrogen compound metabolic process
GO:0009615	0.789	response to virus
GO:0006725	0.783	cellular aromatic compound metabolic process
GO:0048518	0.777	positive regulation of biological process
GO:0019222	0.777	regulation of metabolic process
GO:0006950	0.774	response to stress
GO:0001959	0.772	regulation of cytokine-mediated signaling pathway
GO:0140546	0.742	defense response to symbiont
GO:0048585	0.739	negative regulation of response to stimulus
GO:0051607	0.734	defense response to virus
GO:0048523	0.657	negative regulation of cellular process
GO:0060255	0.654	regulation of macromolecule metabolic process
GO:1901360	0.594	organic cyclic compound metabolic process
GO:0034641	0.589	cellular nitrogen compound metabolic process
GO:0080090	0.587	regulation of primary metabolic process
GO:0051171	0.587	regulation of nitrogen compound metabolic process
GO:0046483	0.578	heterocycle metabolic process
GO:0006139	0.574	nucleobase-containing compound metabolic process
GO:0031323	0.506	regulation of cellular metabolic process
GO:0048522	0.494	positive regulation of cellular process
GO:0090304	0.491	nucleic acid metabolic process
GO:0019219	0.446	regulation of nucleobase-containing compound metabolic process
GO:0051716	0.437	cellular response to stimulus
GO:0010468	0.419	regulation of gene expression
GO:0009893	0.417	positive regulation of metabolic process
GO:0009889	0.385	regulation of biosynthetic process
GO:0010604	0.374	positive regulation of macromolecule metabolic process
GO:0051252	0.368	regulation of RNA metabolic process
GO:0010556	0.365	regulation of macromolecule biosynthetic process
GO:0060338	0.360	regulation of type I interferon-mediated signaling pathway
GO:0031326	0.358	regulation of cellular biosynthetic process
GO:0071840	0.356	cellular component organization or biogenesis
GO:0045824	0.338	negative regulation of innate immune response
GO:0006259	0.325	DNA metabolic process
GO:0016043	0.314	cellular component organization
GO:0002376	0.300	immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005886	0.989	plasma membrane
GO:0043232	0.989	intracellular non-membrane-bounded organelle
GO:0005737	0.792	cytoplasm
GO:0005694	0.726	chromosome
GO:0005829	0.641	cytosol
GO:0090734	0.366	site of DNA damage
GO:0035861	0.355	site of double-strand break

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.999	Acting on ester bonds.
RHEA:15193	0.993	dGTP + H2O = 2'-deoxyguanosine + H(+) + triphosphate
EC:3.1.5.1	0.993	dGTPase.

[back to server]