StarFunc result for job id Q9Y446

User Input

>input (797 residues)
MQDGNFLLSALQPEAGVCSLALPSDLQLDRRGAEGPEAERLRAARVQEQVRARLLQLGQQ
PRHNGAAEPEPEAETARGTSRGQYHTLQAGFSSRSQGLSGDKTSGFRPIAKPAYSPASWS
SRSAVDLSCSRRLSSAHNGGSAFGAAGYGGAQPTPPMPTRPVSFHERGGVGSRADYDTLS
LRSLRLGPGGLDDRYSLVSEQLEPAATSTYRAFAYERQASSSSSRAGGLDWPEATEVSPS
RTIRAPAVRTLQRFQSSHRSRGVGGAVPGAVLEPVARAPSVRSLSLSLADSGHLPDVHGF
NSYGSHRTLQRLSSGFDDIDLPSAVKYLMASDPNLQVLGAAYIQHKCYSDAAAKKQARSL
QAVPRLVKLFNHANQEVQRHATGAMRNLIYDNADNKLALVEENGIFELLRTLREQDDELR
KNVTGILWNLSSSDHLKDRLARDTLEQLTDLVLSPLSGAGGPPLIQQNASEAEIFYNATG
FLRNLSSASQATRQKMRECHGLVDALVTSINHALDAGKCEDKSVENAVCVLRNLSYRLYD
EMPPSALQRLEGRGRRDLAGAPPGEVVGCFTPQSRRLRELPLAADALTFAEVSKDPKGLE
WLWSPQIVGLYNRLLQRCELNRHTTEAAAGALQNITAGDRRWAGVLSRLALEQERILNPL
LDRVRTADHHQLRSLTGLIRNLSRNARNKDEMSTKVVSHLIEKLPGSVGEKSPPAEVLVN
IIAVLNNLVVASPIAARDLLYFDGLRKLIFIKKKRDSPDSEKSSRAASSLLANLWQYNKL
HRDFRAKGYRKEDFLGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QY23	0.659	0.659	2.757E-89	797	0.939	0.939	Q9QY23.pdb.gz	PKP3_MOUSE Plakophilin-3 OS=Mus musculus OX=10090 GN=Pkp3 PE=1 SV=2
2	AFDB:Q99959	0.544	0.496	8.803E-34	881	0.277	0.251	Q99959.pdb.gz	PKP2_HUMAN Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2 PE=1 SV=2
3	AFDB:Q8T2I8	0.242	0.172	1.049E-11	1167	0.138	0.094	Q8T2I8.pdb.gz	SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum OX=44689 GN=sepA PE=2 SV=1
4	PDB:4r0zA	0.337	0.447	9.075E-9	557	0.108	0.154	4r0zA.pdb.gz
5	PDB:2z6gA	0.319	0.427	9.458E-9	550	0.097	0.140	2z6gA.pdb.gz
6	AFDB:Q14669	0.309	0.141	3.201E-8	1992	0.153	0.061	Q14669.pdb.gz	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
7	PDB:1wa5B	0.328	0.506	5.600E-8	466	0.083	0.142	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
8	AFDB:Q55FT4	0.282	0.123	8.288E-8	2247	0.143	0.051	Q55FT4.pdb.gz	TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum OX=44689 GN=tsuA PE=1 SV=1
9	PDB:4tnmA	0.393	0.735	1.783E-7	407	0.092	0.179	4tnmA.pdb.gz
10	PDB:6kbnC	0.349	0.506	4.811E-7	504	0.113	0.179	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
11	PDB:5tbkA	0.378	0.676	5.917E-7	417	0.094	0.180	5tbkA.pdb.gz
12	PDB:7rroH7	0.251	0.317	1.410E-6	580	0.112	0.153	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
13	PDB:3tpoA	0.333	0.537	2.223E-6	438	0.080	0.146	3tpoA.pdb.gz
14	PDB:4hm9A	0.310	0.453	2.414E-6	511	0.092	0.143	4hm9A.pdb.gz
15	AFDB:F4IKX0	0.104	0.090	6.926E-6	1108	0.129	0.093	F4IKX0.pdb.gz	F4IKX0_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR15 PE=1 SV=1
16	PDB:7nscE	0.255	0.306	9.070E-6	615	0.104	0.135	7nscE.pdb.gz
17	AFDB:P25339	0.116	0.111	1.092E-5	888	0.104	0.093	P25339.pdb.gz	PUF4_YEAST Pumilio homology domain family member 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUF4 PE=1 SV=2
18	AFDB:Q585G4	0.126	0.112	2.116E-5	988	0.161	0.130	Q585G4.pdb.gz	Q585G4_TRYB2 Pumilio/PUF RNA binding protein 4, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3A7.50 PE=4 SV=1
19	AFDB:Q6A070	0.163	0.091	2.298E-5	1776	0.134	0.060	Q6A070.pdb.gz	TGRM1_MOUSE TOG array regulator of axonemal microtubules protein 1 OS=Mus musculus OX=10090 GN=Togaram1 PE=1 SV=3
20	AFDB:Q38B85	0.115	0.098	2.602E-5	973	0.124	0.102	Q38B85.pdb.gz	Q38B85_TRYB2 TPR-repeat-containing chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1950 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9QY23	0.0	1524	797	0.939	0.939	PKP3_MOUSE Plakophilin-3 OS=Mus musculus OX=10090 GN=Pkp3 PE=1 SV=2
2	Q9Y446	0.0	1617	797	1.000	1.000	PKP3_HUMAN Plakophilin-3 OS=Homo sapiens OX=9606 GN=PKP3 PE=1 SV=1
3	Q9CQ73	1.81e-80	276	795	0.241	0.242	PKP2_MOUSE Plakophilin-2 OS=Mus musculus OX=10090 GN=Pkp2 PE=1 SV=1
4	Q9UQB3	6.48e-79	278	1225	0.225	0.146	CTND2_HUMAN Catenin delta-2 OS=Homo sapiens OX=9606 GN=CTNND2 PE=1 SV=3
5	B0V2S9	2.11e-76	271	1210	0.223	0.147	B0V2S9_DANRE Catenin (cadherin-associated protein), delta 2b OS=Danio rerio OX=7955 GN=ctnnd2 PE=1 SV=1
6	B0BF33	3.60e-76	265	815	0.208	0.204	PKP2_DANRE Plakophilin-2 OS=Danio rerio OX=7955 GN=pkp2 PE=2 SV=1
7	P97350	2.56e-75	261	728	0.215	0.235	PKP1_MOUSE Plakophilin-1 OS=Mus musculus OX=10090 GN=Pkp1 PE=1 SV=1
8	Q68FH0	6.85e-74	264	1190	0.217	0.145	PKP4_MOUSE Plakophilin-4 OS=Mus musculus OX=10090 GN=Pkp4 PE=1 SV=1
9	Q99569	1.08e-73	263	1192	0.217	0.145	PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 PE=1 SV=2
10	O35927	4.66e-73	262	1247	0.226	0.144	CTND2_MOUSE Catenin delta-2 OS=Mus musculus OX=10090 GN=Ctnnd2 PE=1 SV=1
11	F1M7L9	6.35e-72	253	814	0.213	0.209	PKP2_RAT Plakophilin-2 OS=Rattus norvegicus OX=10116 GN=Pkp2 PE=1 SV=4
12	Q13835	3.37e-71	250	747	0.218	0.233	PKP1_HUMAN Plakophilin-1 OS=Homo sapiens OX=9606 GN=PKP1 PE=1 SV=2
13	Q99959	4.93e-71	252	881	0.208	0.188	PKP2_HUMAN Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2 PE=1 SV=2
14	F1R6C8	7.44e-69	246	908	0.205	0.180	F1R6C8_DANRE Catenin (cadherin-associated protein), delta 1 OS=Danio rerio OX=7955 GN=ctnnd1 PE=1 SV=2
15	A0A286Y8C1	1.72e-68	246	931	0.206	0.176	A0A286Y8C1_DANRE Catenin (cadherin-associated protein), delta 1 OS=Danio rerio OX=7955 GN=ctnnd1 PE=1 SV=2
16	O00192	5.36e-68	244	962	0.213	0.177	ARVC_HUMAN Splicing regulator ARVCF OS=Homo sapiens OX=9606 GN=ARVCF PE=1 SV=1
17	Q8T0H3	1.03e-67	236	562	0.194	0.276	Q8T0H3_DROME LD03740p OS=Drosophila melanogaster OX=7227 GN=p120ctn PE=2 SV=1
18	A0A669KB62	1.63e-67	242	888	0.198	0.178	A0A669KB62_HUMAN Catenin delta 1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1
19	A0A8I5ZVG2	1.72e-67	242	870	0.199	0.183	A0A8I5ZVG2_RAT Catenin delta 1 OS=Rattus norvegicus OX=10116 GN=Ctnnd1 PE=1 SV=1
20	P98203	4.53e-67	242	962	0.211	0.175	ARVC_MOUSE Splicing regulator ARVCF OS=Mus musculus OX=10090 GN=Arvcf PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00514 Arm	9.1e-15	65.3	Armadillo/beta-catenin-like repeat
2	PF17822 ARMH2	4.3e+02	11.8	Armadillo-like helical domain-containing protein 2
3	PF09759 Atx10homo_assoc	63	15.0	Spinocerebellar ataxia type 10 protein domain
4	PF08216 CTNNBL	5.4e+02	10.3	Catenin-beta-like, Arm-motif containing nuclear
5	PF13646 HEAT_2	4.7e+02	12.6	HEAT repeats
6	PF11698 V-ATPase_H_C	4.7e+02	12.3	V-ATPase subunit H

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331678

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369129	0.996	Desmoplakin
2	9606.ENSP00000257189	0.995	Desmoglein-3
3	9606.ENSP00000340510	0.960	Periplakin
4	9606.ENSP00000377508	0.949	Junction plakoglobin
5	9606.ENSP00000261590	0.940	Desmoglein-2
6	9606.ENSP00000353608	0.938	Desmocollin-3
7	9606.ENSP00000257192	0.937	Desmoglein-1
8	9606.ENSP00000257198	0.928	Desmocollin-1
9	9606.ENSP00000280904	0.923	Desmocollin-2
10	9606.ENSP00000352785	0.914	Desmoglein-4
11	9606.ENSP00000397157	0.847	P53 apoptosis effector related to PMP-22
12	9606.ENSP00000301607	0.842	Envoplakin
13	9606.ENSP00000263946	0.836	Plakophilin-1
14	9606.ENSP00000356842	0.831	Cell surface A33 antigen
15	9606.ENSP00000261769	0.797	Cadherin-1
16	9606.ENSP00000027335	0.755	Cadherin-17
17	9606.ENSP00000389714	0.743	Catenin alpha-3
18	9606.ENSP00000449404	0.737	Keratin, type II cytoskeletal 8
19	9606.ENSP00000355124	0.736	Keratin, type I cytoskeletal 19
20	9606.ENSP00000443985	0.732	Cytoplasmic polyadenylation element-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0050839	0.628	cell adhesion molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0010468	0.966	regulation of gene expression
GO:0051252	0.954	regulation of RNA metabolic process
GO:0010605	0.953	negative regulation of macromolecule metabolic process
GO:0048518	0.946	positive regulation of biological process
GO:0031324	0.945	negative regulation of cellular metabolic process
GO:0009894	0.940	regulation of catabolic process
GO:0010604	0.931	positive regulation of macromolecule metabolic process
GO:0071840	0.929	cellular component organization or biogenesis
GO:1902369	0.927	negative regulation of RNA catabolic process
GO:0016043	0.917	cellular component organization
GO:0034329	0.914	cell junction assembly
GO:1903311	0.896	regulation of mRNA metabolic process
GO:0010628	0.857	positive regulation of gene expression
GO:0051179	0.848	localization
GO:0008104	0.844	protein localization
GO:1990778	0.830	protein localization to cell periphery
GO:0007043	0.819	cell-cell junction assembly
GO:1903312	0.817	negative regulation of mRNA metabolic process
GO:0051668	0.697	localization within membrane
GO:0072657	0.597	protein localization to membrane
GO:0061013	0.431	regulation of mRNA catabolic process
GO:1902373	0.415	negative regulation of mRNA catabolic process
GO:0072659	0.387	protein localization to plasma membrane
GO:0032502	0.311	developmental process
GO:0048856	0.304	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005911	0.999	cell-cell junction
GO:0031981	0.996	nuclear lumen
GO:0005654	0.992	nucleoplasm
GO:0001533	0.991	cornified envelope
GO:0032991	0.983	protein-containing complex
GO:0005737	0.746	cytoplasm
GO:0030057	0.479	desmosome
GO:0005912	0.430	adherens junction
GO:1990904	0.397	ribonucleoprotein complex
GO:0005829	0.347	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]