StarFunc result for job id Q9Y458

User Input

>input (520 residues)
MALSSRARAFSVEALVGRPSKRKLQDPIQAEQPELREKKGGEEEEERRSSAAGKSEPLEK
QPKTEPSTSASSGCGSDSGYGNSSESLEEKDIQMELQGSELWKRFHDIGTEMIITKAGRR
MFPSVRVKVKGLDPGKQYHVAIDVVPVDSKRYRYVYHSSQWMVAGNTDHLCIIPRFYVHP
DSPCSGETWMRQIISFDRMKLTNNEMDDKGHIILQSMHKYKPRVHVIEQGSSVDLSQIQS
LPTEGVKTFSFKETEFTTVTAYQNQQITKLKIERNPFAKGFRDTGRNRGVLDGLLETYPW
RPSFTLDFKTFGADTQSGSSGSSPVTSSGGAPSPLNSLLSPLCFSPMFHLPTSSLGMPCP
EAYLPNVNLPLCYKICPTNFWQQQPLVLPAPERLASSNSSQSLAPLMMEVPMLSSLGVTN
SKSGSSEDSSDQYLQAPNSTNQMLYGLQSPGNIFLPNSITPEALSCSFHPSYDFYRYNFS
MPSRLISGSNHLKVNDDSQVSFGEGKCNHVHWYPAINHYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y458	0.999	0.999	1.130E-84	520	1.000	1.000	Q9Y458.pdb.gz	TBX22_HUMAN T-box transcription factor TBX22 OS=Homo sapiens OX=9606 GN=TBX22 PE=1 SV=3
2	AFDB:Q8JFF9	0.402	0.379	2.687E-42	554	0.429	0.403	Q8JFF9.pdb.gz	Q8JFF9_DANRE T-box containing transcription factor OS=Danio rerio OX=7955 GN=tbx18 PE=2 SV=1
3	AFDB:Q9UMR3	0.363	0.421	4.434E-34	447	0.335	0.389	Q9UMR3.pdb.gz	TBX20_HUMAN T-box transcription factor TBX20 OS=Homo sapiens OX=9606 GN=TBX20 PE=1 SV=4
4	AFDB:P70323	0.342	0.370	2.200E-33	479	0.294	0.319	P70323.pdb.gz	TBX1_MOUSE T-box transcription factor TBX1 OS=Mus musculus OX=10090 GN=Tbx1 PE=1 SV=2
5	AFDB:B3DGX3	0.349	0.335	3.023E-31	543	0.285	0.273	B3DGX3.pdb.gz
6	AFDB:O93288	0.356	0.342	8.287E-31	541	0.281	0.270	O93288.pdb.gz	O93288_CHICK T-Box protein 4 OS=Gallus gallus OX=9031 GN=TBX4 PE=1 SV=1
7	AFDB:A0A1D5NXF3	0.360	0.258	4.362E-30	732	0.288	0.205	A0A1D5NXF3.pdb.gz	A0A1D5NXF3_CHICK T-box 3 OS=Gallus gallus OX=9031 GN=TBX3 PE=4 SV=1
8	AFDB:E8Z504	0.358	0.288	1.269E-29	650	0.242	0.194	E8Z504.pdb.gz	E8Z504_SALSA Eomesodermin OS=Salmo salar OX=8030 GN=Eomes PE=2 SV=1
9	AFDB:A2RUW2	0.352	0.268	1.346E-29	689	0.275	0.208	A2RUW2.pdb.gz
10	AFDB:Q16650	0.348	0.267	2.743E-29	682	0.271	0.207	Q16650.pdb.gz	TBR1_HUMAN T-box brain protein 1 OS=Homo sapiens OX=9606 GN=TBR1 PE=1 SV=1
11	PDB:7b0xC	0.109	0.211	2.125E-2	211	0.037	0.090	7b0xC.pdb.gz
12	PDB:5dcaA	0.113	0.036	4.330E-2	1948	0.027	0.007	5dcaA.pdb.gz
13	PDB:7u05A	0.106	0.057	4.595E-2	1114	0.027	0.013	7u05A.pdb.gz
14	PDB:1rowA	0.099	0.299	4.875E-2	107	0.023	0.112	1rowA.pdb.gz
15	PDB:5iv5BJ	0.082	0.049	6.959E-2	1004	0.035	0.018	5iv5BJ.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
16	PDB:7nxdA	0.076	0.051	7.385E-2	905	0.037	0.021	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
17	PDB:2iqyA	0.119	0.259	8.823E-2	190	0.042	0.116	2iqyA.pdb.gz
18	PDB:4g1eA	0.107	0.066	8.823E-2	964	0.044	0.024	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
19	PDB:4n6rB	0.145	0.338	9.362E-2	198	0.035	0.091	4n6rB.pdb.gz
20	PDB:1f13A	0.102	0.078	9.934E-2	722	0.019	0.014	1f13A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y458	0.0	1082	520	1.000	1.000	TBX22_HUMAN T-box transcription factor TBX22 OS=Homo sapiens OX=9606 GN=TBX22 PE=1 SV=3
2	Q96SF7	3.95e-124	377	602	0.398	0.344	TBX15_HUMAN T-box transcription factor TBX15 OS=Homo sapiens OX=9606 GN=TBX15 PE=1 SV=2
3	O70306	2.17e-123	376	602	0.396	0.342	TBX15_MOUSE T-box transcription factor TBX15 OS=Mus musculus OX=10090 GN=Tbx15 PE=1 SV=2
4	O95935	2.17e-116	358	607	0.390	0.334	TBX18_HUMAN T-box transcription factor TBX18 OS=Homo sapiens OX=9606 GN=TBX18 PE=1 SV=3
5	Q9EPZ6	8.86e-116	357	613	0.446	0.378	TBX18_MOUSE T-box transcription factor TBX18 OS=Mus musculus OX=10090 GN=Tbx18 PE=1 SV=1
6	Q8JFF9	1.56e-109	338	554	0.444	0.417	Q8JFF9_DANRE T-box containing transcription factor OS=Danio rerio OX=7955 GN=tbx18 PE=2 SV=1
7	Q8UW76	1.45e-79	257	440	0.290	0.343	TBX20_CHICK T-box transcription factor TBX20 OS=Gallus gallus OX=9031 GN=TBX20 PE=2 SV=1
8	Q8AXW8	3.02e-79	256	441	0.287	0.338	TBX20_XENLA T-box transcription factor TBX20 OS=Xenopus laevis OX=8355 GN=tbx20 PE=2 SV=1
9	Q9I9K7	3.32e-79	256	446	0.290	0.339	TBX20_DANRE T-box transcription factor TBX20 OS=Danio rerio OX=7955 GN=tbx20 PE=2 SV=1
10	Q9ES03	6.32e-77	251	445	0.275	0.321	TBX20_MOUSE T-box transcription factor TBX20 OS=Mus musculus OX=10090 GN=Tbx20 PE=2 SV=3
11	Q9UMR3	1.85e-76	249	447	0.231	0.268	TBX20_HUMAN T-box transcription factor TBX20 OS=Homo sapiens OX=9606 GN=TBX20 PE=1 SV=4
12	Q9VMR2	2.18e-71	240	580	0.250	0.224	Q9VMR2_DROME LP04777p OS=Drosophila melanogaster OX=7227 GN=mid PE=2 SV=1
13	Q8SYY8	4.21e-71	239	571	0.250	0.228	Q8SYY8_DROME RE27439p OS=Drosophila melanogaster OX=7227 GN=mid PE=2 SV=1
14	Q8AXX2	4.71e-70	233	460	0.217	0.246	TBX1_DANRE T-box transcription factor TBX1 OS=Danio rerio OX=7955 GN=tbx1 PE=2 SV=1
15	Q8AX98	1.10e-69	232	463	0.206	0.231	TBX1A_XENLA T-box transcription factor TBX1-A OS=Xenopus laevis OX=8355 GN=tbx1-a PE=1 SV=1
16	P90971	1.47e-69	228	346	0.206	0.309	TBX12_CAEEL T-box protein 12 OS=Caenorhabditis elegans OX=6239 GN=mab-9 PE=1 SV=2
17	O43435	4.86e-69	228	398	0.204	0.266	TBX1_HUMAN T-box transcription factor TBX1 OS=Homo sapiens OX=9606 GN=TBX1 PE=1 SV=1
18	O75333	6.14e-69	228	385	0.204	0.275	TBX10_HUMAN T-box transcription factor TBX10 OS=Homo sapiens OX=9606 GN=TBX10 PE=2 SV=2
19	O17212	4.40e-68	221	252	0.204	0.421	TBX1_CAEEL T-box transcription factor mls-1 OS=Caenorhabditis elegans OX=6239 GN=mls-1 PE=1 SV=1
20	P70323	9.18e-68	228	479	0.202	0.219	TBX1_MOUSE T-box transcription factor TBX1 OS=Mus musculus OX=10090 GN=Tbx1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16874 Glyco_hydro_36C	31	16.4	Glycosyl hydrolase family 36 C-terminal domain
2	PF00907 T-box	4e-71	250.3	T-box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362390

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245816	0.988	ATP-dependent Clp protease proteolytic subunit, mitochondrial
2	9606.ENSP00000300107	0.951	ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial
3	9606.ENSP00000259938	0.912	Colipase
4	9606.ENSP00000294053	0.839	Caseinolytic peptidase B protein homolog
5	9606.ENSP00000343023	0.806	Nuclear autoantigen Sp-100
6	9606.ENSP00000297913	0.722	Olfactory receptor 1Q1
7	9606.ENSP00000372170	0.695	Homeobox protein MSX-1
8	9606.ENSP00000261994	0.677	Protein Z-dependent protease inhibitor
9	9606.ENSP00000374240	0.671	Short stature homeobox protein 2
10	9606.ENSP00000253968	0.655	Homeobox protein BarH-like 1
11	9606.ENSP00000355988	0.655	Interferon regulatory factor 6
12	9606.ENSP00000318480	0.652	ATP-dependent zinc metalloprotease YME1L1
13	9606.ENSP00000355245	0.619	Paired box protein Pax-9
14	9606.ENSP00000414657	0.618	Protein odd-skipped-related 2
15	9606.ENSP00000262041	0.609	Homeobox protein MOX-2
16	9606.ENSP00000266674	0.606	Leucine-rich repeat-containing G-protein coupled receptor 5
17	9606.ENSP00000336994	0.605	Cleft lip and palate transmembrane protein 1
18	9606.ENSP00000358807	0.601	Homeobox protein aristaless-like 3
19	9606.ENSP00000377699	0.587	Adhesion G-protein coupled receptor G4
20	9606.ENSP00000360017	0.579	Zinc finger protein 280C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000977	0.997	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0140110	0.415	transcription regulator activity
GO:0003700	0.371	DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0019222	0.995	regulation of metabolic process
GO:0010468	0.992	regulation of gene expression
GO:0006355	0.979	regulation of DNA-templated transcription
GO:0048519	0.946	negative regulation of biological process
GO:0048523	0.864	negative regulation of cellular process
GO:0006357	0.841	regulation of transcription by RNA polymerase II
GO:1903507	0.837	negative regulation of nucleic acid-templated transcription
GO:0045892	0.834	negative regulation of DNA-templated transcription
GO:0009987	0.826	cellular process
GO:0048518	0.789	positive regulation of biological process
GO:0048522	0.626	positive regulation of cellular process
GO:0032502	0.567	developmental process
GO:0048856	0.563	anatomical structure development
GO:0032501	0.550	multicellular organismal process
GO:0050896	0.516	response to stimulus
GO:0007275	0.514	multicellular organism development
GO:0000122	0.490	negative regulation of transcription by RNA polymerase II
GO:0009893	0.403	positive regulation of metabolic process
GO:0048731	0.390	system development
GO:0010604	0.388	positive regulation of macromolecule metabolic process
GO:0009653	0.370	anatomical structure morphogenesis
GO:0051173	0.365	positive regulation of nitrogen compound metabolic process
GO:0031325	0.354	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.703	intracellular organelle lumen
GO:0005737	0.656	cytoplasm
GO:0032991	0.446	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]