StarFunc result for job id Q9Y462

User Input

>input (761 residues)
MDSGGGSLGLHTPDSRMAHTMIMQDFVAGMAGTAHIDGDHIVVSVPEAVLVSDVVTDDGI
TLDHGLAAEVVHGPDIITETDVVTEGVIVPEAVLEADVAIEEDLEEDDGDHILTSELITE
TVRVPEQVFVADLVTGPNGHLEHVVQDCVSGVDSPTMVSEEVLVTNSDTETVIQAAGGVP
GSTVTIKTEDDDDDDVKSTSEDYLMISLDDVGEKLEHMGNTPLKIGSDGSQEDAKEDGFG
SEVIKVYIFKAEAEDDVEIGGTEIVTESEYTSGHSVAGVLDQSRMQREKMVYMAVKDSSQ
EEDDIRDERRVSRRYEDCQASGNTLDSALESRSSTAAQYLQICDGINTNKVLKQKAKKRR
RGETRQWQTAVIIGPDGQPLTVYPCHICTKKFKSRGFLKRHMKNHPDHLMRKKYQCTDCD
FTTNKKVSFHNHLESHKLINKVDKTHEFTEYTRRYREASPLSSNKLILRDKEPKMHKCKY
CDYETAEQGLLNRHLLAVHSKNFPHVCVECGKGFRHPSELKKHMRTHTGEKPYQCQYCIF
RCADQSNLKTHIKSKHGNNLPYKCEHCPQAFGDERELQRHLDLFQGHKTHQCPHCDHKST
NSSDLKRHIISVHTKDFPHKCEVCDKGFHRPSELKKHSDIHKGRKIHQCRHCDFKTSDPF
ILSGHILSVHTKDQPLKCKRCKRGFRQQNELKKHMKTHTGRKIYQCEYCEYSTTDASGFK
RHVISIHTKDYPHRCEFCKKGFRRPSEKNQHIMRHHKEALM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y462	1.000	1.000	0.000	761	1.000	1.000	Q9Y462.pdb.gz	ZN711_HUMAN Zinc finger protein 711 OS=Homo sapiens OX=9606 GN=ZNF711 PE=1 SV=2
2	AFDB:A0A024RC04	0.293	0.280	4.283E-67	805	0.577	0.545	A0A024RC04.pdb.gz
3	AFDB:E9PEP7	0.294	0.295	2.181E-65	755	0.545	0.550	E9PEP7.pdb.gz	E9PEP7_HUMAN Zinc finger protein X-linked OS=Homo sapiens OX=9606 GN=ZFX PE=1 SV=1
4	AFDB:P20662	0.366	0.360	7.641E-64	777	0.474	0.465	P20662.pdb.gz	ZFY2_MOUSE Zinc finger Y-chromosomal protein 2 OS=Mus musculus OX=10090 GN=Zfy2 PE=2 SV=2
5	AFDB:P57071	0.222	0.127	8.708E-20	1507	0.216	0.109	P57071.pdb.gz	PRD15_HUMAN PR domain zinc finger protein 15 OS=Homo sapiens OX=9606 GN=PRDM15 PE=1 SV=4
6	AFDB:Q8N1G0	0.083	0.059	1.239E-12	1237	0.192	0.118	Q8N1G0.pdb.gz	ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1
7	AFDB:Q923B3	0.103	0.096	5.602E-10	828	0.141	0.129	Q923B3.pdb.gz	NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus OX=10090 GN=Nrif1 PE=1 SV=3
8	AFDB:M9NEG1	0.096	0.067	2.236E-7	1109	0.152	0.105	M9NEG1.pdb.gz	M9NEG1_DROME Maternal gene required for meiosis, isoform F OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=1
9	AFDB:Q8I7Z8	0.085	0.069	4.728E-7	990	0.131	0.101	Q8I7Z8.pdb.gz	HAM_DROME Transcription factor hamlet OS=Drosophila melanogaster OX=7227 GN=ham PE=2 SV=1
10	AFDB:Q9V5M3	0.123	0.109	3.270E-6	878	0.146	0.126	Q9V5M3.pdb.gz	LOLA6_DROME Longitudinals lacking protein, isoforms N/O/W/X/Y OS=Drosophila melanogaster OX=7227 GN=lola PE=1 SV=3
11	PDB:3w5kB	0.062	0.283	1.038E-4	110	0.043	0.300	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ydhA	0.035	0.207	4.719E-1	62	0.013	0.161	6ydhA.pdb.gz
13	PDB:7pt6I	0.047	0.082	5.691E-1	341	0.041	0.091	7pt6I.pdb.gz	The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.
14	PDB:4kblA	0.046	0.072	6.862E-1	395	0.034	0.066	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
15	PDB:7qhsG	0.038	0.038	7.774E-1	756	0.032	0.032	7qhsG.pdb.gz	Mechanism of replication origin melting nucleated by CMG helicase assembly.
16	PDB:4btsA9	0.035	0.207	8.807E-1	93	0.020	0.161	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
17	PDB:5apny	0.042	0.107	8.807E-1	211	0.037	0.133	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
18	PDB:5vsuA	0.048	0.075	9.374E-1	387	0.050	0.098	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
19	PDB:7qcdD	0.047	0.095	9.374E-1	326	0.026	0.061	7qcdD.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
20	PDB:5dkaA	0.036	0.218	1.130	96	0.022	0.177	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7Y7X5	0.0	1047	761	0.710	0.710	ZN711_DANRE Zinc finger protein 711 OS=Danio rerio OX=7955 GN=znf711 PE=1 SV=1
2	E9PEP7	0.0	740	755	0.537	0.542	E9PEP7_HUMAN Zinc finger protein X-linked OS=Homo sapiens OX=9606 GN=ZFX PE=1 SV=1
3	P08048	0.0	814	801	0.581	0.552	ZFY_HUMAN Zinc finger Y-chromosomal protein OS=Homo sapiens OX=9606 GN=ZFY PE=1 SV=3
4	P17010	0.0	817	805	0.580	0.548	ZFX_HUMAN Zinc finger X-chromosomal protein OS=Homo sapiens OX=9606 GN=ZFX PE=2 SV=2
5	P17012	0.0	831	799	0.594	0.566	ZFX_MOUSE Zinc finger X-chromosomal protein OS=Mus musculus OX=10090 GN=Zfx PE=1 SV=2
6	P20662	0.0	660	777	0.484	0.474	ZFY2_MOUSE Zinc finger Y-chromosomal protein 2 OS=Mus musculus OX=10090 GN=Zfy2 PE=2 SV=2
7	Q9Y462	0.0	1576	761	1.000	1.000	ZN711_HUMAN Zinc finger protein 711 OS=Homo sapiens OX=9606 GN=ZNF711 PE=1 SV=2
8	Q05481	1.28e-49	191	1191	0.171	0.109	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
9	Q03923	8.43e-48	181	595	0.189	0.242	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
10	A6NNF4	8.84e-48	181	616	0.163	0.201	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
11	P17038	2.72e-47	182	809	0.183	0.172	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
12	Q49A12	3.14e-47	178	536	0.189	0.269	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
13	P35789	1.40e-46	177	620	0.168	0.206	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
14	Q96PQ6	5.39e-46	176	595	0.159	0.203	ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens OX=9606 GN=ZNF317 PE=1 SV=2
15	Q32M78	6.50e-46	176	642	0.167	0.198	ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens OX=9606 GN=ZNF699 PE=1 SV=1
16	Q60821	1.43e-45	177	794	0.139	0.134	ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus OX=10090 GN=Zbtb17 PE=1 SV=2
17	Q8IYB9	1.44e-45	175	648	0.160	0.188	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
18	Q14585	2.82e-45	171	488	0.159	0.248	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1
19	Q02386	3.39e-45	174	682	0.166	0.185	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
20	Q13105	4.47e-45	176	803	0.139	0.132	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02748 PyrI_C	4.9e+02	12.0	Aspartate carbamoyltransferase regulatory chain, metal binding domain
2	PF00096 zf-C2H2	1.6e-34	127.5	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	6.8e-27	102.8	C2H2-type zinc finger
4	PF12171 zf-C2H2_jaz	8e-07	40.4	Zinc-finger double-stranded RNA-binding
5	PF16278 zf-C2HE	49	15.8	C2HE / C2H2 / C2HC zinc-binding finger
6	PF13465 zf-H2C2_2	2.3e-34	127.5	Zinc-finger double domain
7	PF13909 zf-H2C2_5	7.6e-22	88.0	C2H2-type zinc-finger domain
8	PF04704 Zfx_Zfy_act	4.2e-88	307.2	Zfx / Zfy transcription activation region
9	PF17032 zinc_ribbon_15	0.0016	30.5	zinc-ribbon family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362260

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000350676	0.828	Histone lysine demethylase PHF8
2	9606.ENSP00000262753	0.823	Protein POF1B
3	9606.ENSP00000321348	0.744	Protein diaphanous homolog 2
4	9606.ENSP00000251038	0.716	Zinc finger CCCH domain-containing protein 14
5	9606.ENSP00000396452	0.711	Pseudouridine-5'-phosphatase
6	9606.ENSP00000362095	0.693	Sushi repeat-containing protein SRPX2
7	9606.ENSP00000316891	0.685	LIM and calponin homology domains 1
8	9606.ENSP00000471604	0.622	Testis-expressed protein 13A
9	9606.ENSP00000303777	0.616	Testis-expressed protein 13B
10	9606.ENSP00000425421	0.615	Spermidine/spermine N1-acetyl transferase like 1
11	9606.ENSP00000329097	0.614	PHD finger protein 6
12	9606.ENSP00000370519	0.604	Arylsulfatase F
13	9606.ENSP00000362372	0.595	Bromodomain and WD repeat-containing protein 3
14	9606.ENSP00000379612	0.583	Tax1-binding protein 1
15	9606.ENSP00000395220	0.580	Synaptotagmin-like protein 5
16	9606.ENSP00000362441	0.550	Transcriptional regulator ATRX
17	9606.ENSP00000362465	0.532	Palmitoyltransferase ZDHHC15
18	9606.ENSP00000364550	0.524	Lysine-specific demethylase 5C
19	9606.ENSP00000318086	0.511	MAP7 domain-containing protein 3
20	9606.ENSP00000362206	0.502	Kelch-like protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	0.999	sequence-specific DNA binding
GO:0140110	0.339	transcription regulator activity
GO:0003700	0.302	DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0010468	0.991	regulation of gene expression
GO:0031323	0.985	regulation of cellular metabolic process
GO:0080090	0.981	regulation of primary metabolic process
GO:0051171	0.981	regulation of nitrogen compound metabolic process
GO:0031326	0.969	regulation of cellular biosynthetic process
GO:0051252	0.965	regulation of RNA metabolic process
GO:0006355	0.957	regulation of DNA-templated transcription
GO:0006357	0.780	regulation of transcription by RNA polymerase II
GO:0009987	0.771	cellular process
GO:0048518	0.728	positive regulation of biological process
GO:0045944	0.699	positive regulation of transcription by RNA polymerase II
GO:0048519	0.307	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.988	nuclear lumen
GO:0005654	0.976	nucleoplasm
GO:0043232	0.838	intracellular non-membrane-bounded organelle
GO:0005737	0.725	cytoplasm
GO:0005730	0.421	nucleolus
GO:0071944	0.308	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]