StarFunc result for job id Q9Y463

User Input

>input (629 residues)
MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDATSAPLRKLSVDLIKTYKHIN
EVYYAKKKRRAQQAPPQDSSNKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKG
SFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHF
MFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLG
CILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERLPGGGWTLRRT
KELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARI
SPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSSGGSSGSSSDN
RTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGA
QLPPQPRYLGRPPSPTSPPPPELMDVSLVGGPADCSPPHPAPAPQHPAASALRTRMTGGR
PPLPPPDDPATLGPHLGLRGVPQSTAASS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R0I0	0.613	0.613	2.136E-93	629	1.000	1.000	A0A024R0I0.pdb.gz
2	AFDB:A0A024R0M8	0.533	0.557	1.037E-85	601	0.955	1.000	A0A024R0M8.pdb.gz
3	AFDB:D1L3Y5	0.632	0.531	5.227E-69	751	0.657	0.550	D1L3Y5.pdb.gz	D1L3Y5_DANRE dual-specificity kinase OS=Danio rerio OX=7955 GN=si:ch211-225p5.1 PE=2 SV=1
4	AFDB:A1L1U2	0.607	0.521	3.260E-66	737	0.610	0.521	A1L1U2.pdb.gz	A1L1U2_DANRE dual-specificity kinase OS=Danio rerio OX=7955 GN=dyrk1a PE=2 SV=1
5	AFDB:Q76NV1	0.553	0.417	1.328E-46	836	0.375	0.282	Q76NV1.pdb.gz	DYRK1_DICDI Probable serine/threonine-protein kinase dyrk1 OS=Dictyostelium discoideum OX=44689 GN=dyrk1 PE=3 SV=1
6	AFDB:Q9V3D5	0.514	0.449	1.982E-37	722	0.286	0.249	Q9V3D5.pdb.gz	DYRK2_DROME Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Drosophila melanogaster OX=7227 GN=Dyrk2 PE=1 SV=1
7	AFDB:F1QLC1	0.498	0.537	9.229E-36	582	0.256	0.277	F1QLC1.pdb.gz
8	AFDB:O43781	0.486	0.519	8.009E-34	588	0.245	0.262	O43781.pdb.gz	DYRK3_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Homo sapiens OX=9606 GN=DYRK3 PE=1 SV=3
9	PDB:5y86A	0.485	0.763	1.423E-33	395	0.226	0.359	5y86A.pdb.gz	Crystal Structure of Human Dual-Specificity Tyrosine-Regulated Kinase 3 Reveals New Structural Features and Insights into its Auto-phosphorylation
10	AFDB:Q9XTF3	0.501	0.390	5.949E-32	817	0.248	0.191	Q9XTF3.pdb.gz	MBK2_CAEEL Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 OS=Caenorhabditis elegans OX=6239 GN=mbk-2 PE=1 SV=1
11	AFDB:Q922Y0	0.489	0.523	6.266E-32	586	0.235	0.253	Q922Y0.pdb.gz	DYRK3_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Mus musculus OX=10090 GN=Dyrk3 PE=1 SV=1
12	PDB:6kheA	0.476	0.862	4.190E-27	342	0.184	0.339	6kheA.pdb.gz	Structural Basis for the Selective Inhibition of Cdc2-Like Kinases by CX-4945.
13	PDB:6khdB	0.456	0.851	1.988E-26	332	0.180	0.340	6khdB.pdb.gz	Structural Basis for the Selective Inhibition of Cdc2-Like Kinases by CX-4945.
14	PDB:6qx9K	0.454	0.873	8.502E-26	322	0.176	0.345	6qx9K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
15	PDB:6fadC	0.452	0.767	8.955E-26	359	0.161	0.281	6fadC.pdb.gz	Molecular Mechanism of SR Protein Kinase 1 Inhibition by the Herpes Virus Protein ICP27.
16	PDB:4yc3A	0.408	0.833	3.484E-20	295	0.154	0.329	4yc3A.pdb.gz
17	PDB:4krcA	0.408	0.832	7.205E-20	297	0.149	0.316	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
18	PDB:1unlA	0.400	0.830	1.343E-19	292	0.156	0.336	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
19	PDB:4eomC	0.374	0.830	1.741E-19	276	0.157	0.359	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
20	PDB:5xvuA	0.400	0.752	4.824E-18	321	0.134	0.262	5xvuA.pdb.gz	The protein kinase CK2 catalytic domain from Plasmodium falciparum: crystal structure, tyrosine kinase activity and inhibition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4II39	0.0	755	681	0.661	0.611	A0A0R4II39_DANRE dual-specificity kinase OS=Danio rerio OX=7955 GN=si:ch211-225p5.1 PE=3 SV=1
2	A1L1U2	0.0	690	737	0.526	0.449	A1L1U2_DANRE dual-specificity kinase OS=Danio rerio OX=7955 GN=dyrk1a PE=2 SV=1
3	D1L3Y5	0.0	759	751	0.661	0.554	D1L3Y5_DANRE dual-specificity kinase OS=Danio rerio OX=7955 GN=si:ch211-225p5.1 PE=2 SV=1
4	P49657	0.0	676	908	0.509	0.352	MNB_DROME Serine/threonine-protein kinase minibrain OS=Drosophila melanogaster OX=7227 GN=mnb PE=1 SV=2
5	Q13627	0.0	731	763	0.599	0.494	DYR1A_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A PE=1 SV=2
6	Q61214	0.0	732	763	0.599	0.494	DYR1A_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Mus musculus OX=10090 GN=Dyrk1a PE=1 SV=1
7	Q63470	0.0	733	763	0.599	0.494	DYR1A_RAT Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Rattus norvegicus OX=10116 GN=Dyrk1a PE=1 SV=2
8	Q9Y463	0.0	1290	629	1.000	1.000	DYR1B_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Homo sapiens OX=9606 GN=DYRK1B PE=1 SV=1
9	Q9Z188	0.0	1249	629	0.973	0.973	DYR1B_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Mus musculus OX=10090 GN=Dyrk1b PE=1 SV=3
10	Q8WQL7	7.13e-165	496	882	0.383	0.273	MBK1_CAEEL Dual specificity tyrosine-phosphorylation-regulated kinase mbk-1 OS=Caenorhabditis elegans OX=6239 GN=mbk-1 PE=1 SV=1
11	Q76NV1	2.70e-157	474	836	0.345	0.260	DYRK1_DICDI Probable serine/threonine-protein kinase dyrk1 OS=Dictyostelium discoideum OX=44689 GN=dyrk1 PE=3 SV=1
12	Q9V3D5	3.26e-94	307	722	0.267	0.233	DYRK2_DROME Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Drosophila melanogaster OX=7227 GN=Dyrk2 PE=1 SV=1
13	Q9NR20	8.70e-93	298	520	0.262	0.317	DYRK4_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 4 OS=Homo sapiens OX=9606 GN=DYRK4 PE=1 SV=2
14	A0A0A0MTH5	4.21e-92	299	634	0.272	0.270	A0A0A0MTH5_HUMAN dual-specificity kinase OS=Homo sapiens OX=9606 GN=DYRK4 PE=1 SV=1
15	Q9P6P3	2.06e-91	294	534	0.273	0.322	PPK15_SCHPO Serine/threonine-protein kinase ppk15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk15 PE=1 SV=1
16	Q9XTF3	1.76e-90	300	817	0.253	0.195	MBK2_CAEEL Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 OS=Caenorhabditis elegans OX=6239 GN=mbk-2 PE=1 SV=1
17	A9JRD5	3.38e-90	293	581	0.250	0.270	A9JRD5_DANRE dual-specificity kinase OS=Danio rerio OX=7955 GN=dyrk2 PE=2 SV=1
18	Q92630	1.32e-89	291	601	0.264	0.276	DYRK2_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Homo sapiens OX=9606 GN=DYRK2 PE=1 SV=3
19	Q5U4C9	1.40e-89	291	599	0.264	0.277	DYRK2_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Mus musculus OX=10090 GN=Dyrk2 PE=2 SV=1
20	Q922Y0	1.79e-87	286	586	0.237	0.254	DYRK3_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Mus musculus OX=10090 GN=Dyrk3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	98	14.2	Phosphotransferase enzyme family
2	PF01633 Choline_kinase	3.3e+02	12.3	Choline/ethanolamine kinase
3	PF00069 Pkinase	3.4e-46	169.3	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	1.3e-18	78.9	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000469863

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000483236	0.994	DDB1- and CUL4-associated factor 7
2	9606.ENSP00000421544	0.927	Pterin-4-alpha-carbinolamine dehydratase 2
3	9606.ENSP00000299299	0.852	Pterin-4-alpha-carbinolamine dehydratase
4	9606.ENSP00000257555	0.807	Hepatocyte nuclear factor 1-alpha
5	9606.ENSP00000239906	0.800	Protein FAM53C
6	9606.ENSP00000011619	0.775	Ran-binding protein 9
7	9606.ENSP00000407586	0.739	GTPase HRas
8	9606.ENSP00000299563	0.718	E3 ubiquitin-protein ligase RNF169
9	9606.ENSP00000375073	0.694	EP300-interacting inhibitor of differentiation 2
10	9606.ENSP00000363259	0.683	Uncharacterized protein C10orf71
11	9606.ENSP00000359240	0.623	Leucine zipper putative tumor suppressor 2
12	9606.ENSP00000451812	0.602	Protein lin-52 homolog
13	9606.ENSP00000257909	0.586	Tastin
14	9606.ENSP00000262133	0.581	Retinoblastoma-like protein 2
15	9606.ENSP00000370527	0.567	Calcipressin-1
16	9606.ENSP00000466897	0.567	Cold-inducible RNA-binding protein
17	9606.ENSP00000287859	0.556	Protein odr-4 homolog
18	9606.ENSP00000375904	0.545	Galectin-16
19	9606.ENSP00000365005	0.536	Mitogen-activated protein kinase kinase kinase 19
20	9606.ENSP00000254301	0.535	Galectin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0003712	0.997	transcription coregulator activity
GO:0003713	0.836	transcription coactivator activity
GO:0097159	0.443	organic cyclic compound binding
GO:1901363	0.442	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.980	regulation of cellular process
GO:0048856	0.956	anatomical structure development
GO:0019222	0.916	regulation of metabolic process
GO:0060255	0.865	regulation of macromolecule metabolic process
GO:0031323	0.842	regulation of cellular metabolic process
GO:0051171	0.837	regulation of nitrogen compound metabolic process
GO:0080090	0.836	regulation of primary metabolic process
GO:0008152	0.831	metabolic process
GO:0006807	0.787	nitrogen compound metabolic process
GO:0044237	0.781	cellular metabolic process
GO:0048518	0.776	positive regulation of biological process
GO:0071704	0.739	organic substance metabolic process
GO:0140253	0.714	cell-cell fusion
GO:0006949	0.714	syncytium formation
GO:0044238	0.686	primary metabolic process
GO:0014902	0.675	myotube differentiation
GO:0048522	0.666	positive regulation of cellular process
GO:0019219	0.666	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.663	regulation of biosynthetic process
GO:0051173	0.663	positive regulation of nitrogen compound metabolic process
GO:0010604	0.662	positive regulation of macromolecule metabolic process
GO:0061448	0.659	connective tissue development
GO:0031325	0.637	positive regulation of cellular metabolic process
GO:0060612	0.623	adipose tissue development
GO:0043170	0.587	macromolecule metabolic process
GO:0031326	0.559	regulation of cellular biosynthetic process
GO:0051252	0.547	regulation of RNA metabolic process
GO:0010468	0.543	regulation of gene expression
GO:0010556	0.543	regulation of macromolecule biosynthetic process
GO:0006355	0.534	regulation of DNA-templated transcription
GO:0000768	0.481	syncytium formation by plasma membrane fusion
GO:1901564	0.478	organonitrogen compound metabolic process
GO:0009891	0.426	positive regulation of biosynthetic process
GO:0045935	0.419	positive regulation of nucleobase-containing compound metabolic process
GO:0019538	0.418	protein metabolic process
GO:0036211	0.368	protein modification process
GO:0050896	0.346	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0005694	0.941	chromosome
GO:0005829	0.881	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]