StarFunc result for job id Q9Y466

User Input

>input (385 residues)
MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGGC
PVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENGAAAHF
PSAALPAPAFFTAVTQLEPHGLELAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEV
ATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDAN
TLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTH
SGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEE
VFFKKTIGNVPITRLLSDMYKSSDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q64104	0.604	0.604	4.728E-48	385	0.990	0.990	Q64104.pdb.gz	NR2E1_MOUSE Nuclear receptor subfamily 2 group E member 1 OS=Mus musculus OX=10090 GN=Nr2e1 PE=1 SV=1
2	AFDB:P18102	0.515	0.442	1.091E-26	452	0.460	0.392	P18102.pdb.gz	TLL_DROME Protein tailless OS=Drosophila melanogaster OX=7227 GN=tll PE=1 SV=1
3	AFDB:F1QGF3	0.472	0.429	1.369E-25	426	0.460	0.415	F1QGF3.pdb.gz
4	AFDB:Q9Y5X4	0.486	0.458	3.833E-25	410	0.447	0.420	Q9Y5X4.pdb.gz	NR2E3_HUMAN Photoreceptor-specific nuclear receptor OS=Homo sapiens OX=9606 GN=NR2E3 PE=1 SV=1
5	AFDB:P10588	0.671	0.643	5.024E-24	404	0.364	0.347	P10588.pdb.gz	NR2F6_HUMAN Nuclear receptor subfamily 2 group F member 6 OS=Homo sapiens OX=9606 GN=NR2F6 PE=1 SV=2
6	AFDB:Q06726	0.537	0.514	1.087E-23	403	0.353	0.337	Q06726.pdb.gz	NR2F5_DANRE Nuclear receptor subfamily 2 group F member 5 OS=Danio rerio OX=7955 GN=nr2f5 PE=2 SV=1
7	AFDB:P10589	0.611	0.564	2.563E-23	423	0.358	0.326	P10589.pdb.gz	COT1_HUMAN COUP transcription factor 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
8	AFDB:B3DGQ7	0.544	0.492	2.793E-23	428	0.343	0.308	B3DGQ7.pdb.gz
9	AFDB:F1D8R0	0.524	0.488	4.289E-23	414	0.361	0.336	F1D8R0.pdb.gz	F1D8R0_HUMAN Ovalbumin upstream promoter-transcription factor II variant 1 OS=Homo sapiens OX=9606 GN=NR2F2 PE=2 SV=1
10	AFDB:P16375	0.518	0.372	1.200E-22	543	0.364	0.258	P16375.pdb.gz	7UP1_DROME Steroid receptor seven-up, isoforms B/C OS=Drosophila melanogaster OX=7227 GN=svp PE=1 SV=1
11	PDB:3dzyA	0.558	0.689	1.975E-14	302	0.296	0.377	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:6fx0A	0.416	0.642	2.393E-6	238	0.130	0.210	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:1g2nA	0.396	0.593	4.003E-6	246	0.148	0.232	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.358	0.509	1.185E-4	259	0.114	0.170	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:4o9yA	0.083	0.023	1.084E-1	2490	0.135	0.021	4o9yA.pdb.gz
16	PDB:6af6A	0.116	0.117	4.865E-1	383	0.044	0.044	6af6A.pdb.gz	Crystal Structure of PigA: A Prolyl Thioester-Oxidizing Enzyme in Prodigiosin Biosynthesis.
17	PDB:6xboA	0.120	0.135	6.028E-1	319	0.083	0.100	6xboA.pdb.gz	Inhibition of CMP-sialic acid transport by endogenous 5-methyl CMP.
18	PDB:5sv0A	0.102	0.146	6.568E-1	233	0.086	0.142	5sv0A.pdb.gz
19	PDB:7uw9i	0.128	0.240	6.856E-1	156	0.042	0.103	7uw9i.pdb.gz
20	PDB:1ekuB	0.105	0.147	8.139E-1	254	0.065	0.098	1ekuB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q64104	0.0	796	385	0.990	0.990	NR2E1_MOUSE Nuclear receptor subfamily 2 group E member 1 OS=Mus musculus OX=10090 GN=Nr2e1 PE=1 SV=1
2	Q9Y466	0.0	804	385	1.000	1.000	NR2E1_HUMAN Nuclear receptor subfamily 2 group E member 1 OS=Homo sapiens OX=9606 GN=NR2E1 PE=1 SV=1
3	P18102	8.86e-108	325	452	0.460	0.392	TLL_DROME Protein tailless OS=Drosophila melanogaster OX=7227 GN=tll PE=1 SV=1
4	Q9Y5X4	3.01e-98	300	410	0.429	0.402	NR2E3_HUMAN Photoreceptor-specific nuclear receptor OS=Homo sapiens OX=9606 GN=NR2E3 PE=1 SV=1
5	Q5U3F3	9.21e-98	299	419	0.455	0.418	Q5U3F3_DANRE Nuclear receptor subfamily 2, group E, member 3 OS=Danio rerio OX=7955 GN=zgc:103631 PE=2 SV=1
6	Q9QXZ7	3.23e-97	296	395	0.434	0.423	NR2E3_MOUSE Photoreceptor-specific nuclear receptor OS=Mus musculus OX=10090 GN=Nr2e3 PE=1 SV=1
7	A0A8I6A7N1	1.59e-85	267	398	0.382	0.369	A0A8I6A7N1_RAT Nuclear receptor subfamily 2, group F, member 1 OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=3 SV=1
8	F1DAL9	2.20e-85	266	398	0.382	0.369	F1DAL9_HUMAN Nuclear receptor subfamily 2 group F member 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
9	F2Z3S9	3.68e-85	266	420	0.382	0.350	F2Z3S9_RAT Nuclear receptor subfamily 2, group F, member 1 OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=3 SV=1
10	P10589	5.25e-85	266	423	0.382	0.348	COT1_HUMAN COUP transcription factor 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
11	Q60632	5.56e-85	266	422	0.382	0.348	COT1_MOUSE COUP transcription factor 1 OS=Mus musculus OX=10090 GN=Nr2f1 PE=2 SV=2
12	F1DAL7	1.31e-84	263	372	0.374	0.387	F1DAL7_HUMAN Nuclear receptor subfamily 2 group F member 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
13	Q91430	1.37e-84	265	422	0.369	0.336	Q91430_DANRE COUP transcription factor 2 OS=Danio rerio OX=7955 GN=svp[40] PE=1 SV=1
14	Q06725	4.57e-84	263	411	0.371	0.348	N2F1A_DANRE Nuclear receptor subfamily 2 group F member 1-A OS=Danio rerio OX=7955 GN=nr2f1a PE=2 SV=1
15	A0A060YH15	9.59e-84	262	391	0.369	0.363	A0A060YH15_ONCMY COUP transcription factor 1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00037055001 PE=3 SV=1
16	Q62681	2.84e-83	261	419	0.379	0.348	Q62681_RAT Orphan receptor COUP-TFI OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=2 SV=1
17	F1D8R0	8.12e-83	260	414	0.361	0.336	F1D8R0_HUMAN Ovalbumin upstream promoter-transcription factor II variant 1 OS=Homo sapiens OX=9606 GN=NR2F2 PE=2 SV=1
18	P24468	8.12e-83	260	414	0.361	0.336	COT2_HUMAN COUP transcription factor 2 OS=Homo sapiens OX=9606 GN=NR2F2 PE=1 SV=1
19	P43135	8.12e-83	260	414	0.361	0.336	COT2_MOUSE COUP transcription factor 2 OS=Mus musculus OX=10090 GN=Nr2f2 PE=1 SV=2
20	O09018	9.44e-83	260	414	0.361	0.336	COT2_RAT COUP transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Nr2f2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	7.8e-29	112.3	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	1.8e-25	100.5	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010380794.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010362667.1	0.844	Histone demethylase that demethylates both 'Lys-4' (H3K4me) and 'Lys-9' (H3K9me) of histone H3, thereby acting as a coactivator or a corepressor, depending on the context. Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed. Acts as a corepressor by mediating demethylation of H3K4me, a specific tag for epigenetic transcriptional activation. Demethylates both mono- (H3K4me1) and di-methylated (H3K4me2) H3K4me
2	61622.XP_010384194.1	0.835	Atrophin 1
3	61622.XP_010352243.1	0.805	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events
4	61622.XP_010351736.1	0.793	Transducin-like enhancer protein 1 isoform X1
5	61622.XP_010361952.1	0.793	Transducin-like enhancer protein 3 isoform X1
6	61622.XP_010372324.1	0.793	Transducin-like enhancer protein 4
7	61622.XP_010362494.1	0.710	Arginine-glutamic acid dipeptide repeats protein isoform X1
8	61622.XP_010366717.1	0.664	Nuclear receptor corepressor 2
9	61622.XP_010386050.1	0.662	Nuclear receptor corepressor 1
10	61622.XP_010381212.1	0.647	MDS1 and EVI1 complex locus
11	61622.XP_010377616.1	0.643	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
12	61622.XP_010364315.1	0.597	G-protein coupled receptor 6 isoform X1
13	61622.XP_010360252.1	0.596	PR domain zinc finger protein 16
14	61622.XP_010357286.1	0.592	Glutamate receptor ionotropic, kainate 5
15	61622.XP_010378270.1	0.591	Bromodomain PHD finger transcription factor
16	61622.XP_010372970.1	0.590	Forkhead box protein G1
17	61622.XP_010374473.1	0.590	Nuclear receptor-interacting protein 1
18	61622.XP_010354006.1	0.585	Low density lipoprotein receptor adaptor protein 1
19	61622.XP_010376318.1	0.573	PDZ domain-containing protein 2
20	61622.XP_010357359.1	0.567	F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.999	cis-regulatory region sequence-specific DNA binding
GO:0000977	0.999	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0038023	0.998	signaling receptor activity
GO:0000978	0.992	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0008134	0.711	transcription factor binding
GO:0098531	0.637	ligand-activated transcription factor activity
GO:0003707	0.542	nuclear steroid receptor activity
GO:0004879	0.541	nuclear receptor activity
GO:0019899	0.433	enzyme binding
GO:0001216	0.347	DNA-binding transcription activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.999	multicellular organismal process
GO:0048856	0.997	anatomical structure development
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0048731	0.985	system development
GO:0019222	0.968	regulation of metabolic process
GO:0010468	0.959	regulation of gene expression
GO:0010556	0.956	regulation of macromolecule biosynthetic process
GO:0031326	0.956	regulation of cellular biosynthetic process
GO:0019219	0.955	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.946	regulation of DNA-templated transcription
GO:0007399	0.933	nervous system development
GO:0048518	0.852	positive regulation of biological process
GO:0048523	0.851	negative regulation of cellular process
GO:0006357	0.754	regulation of transcription by RNA polymerase II
GO:1902679	0.677	negative regulation of RNA biosynthetic process
GO:0050896	0.660	response to stimulus
GO:1903507	0.654	negative regulation of nucleic acid-templated transcription
GO:0048522	0.619	positive regulation of cellular process
GO:0071840	0.604	cellular component organization or biogenesis
GO:0045892	0.579	negative regulation of DNA-templated transcription
GO:0009893	0.578	positive regulation of metabolic process
GO:0016043	0.559	cellular component organization
GO:0010604	0.509	positive regulation of macromolecule metabolic process
GO:0048513	0.476	animal organ development
GO:0030154	0.458	cell differentiation
GO:0051239	0.442	regulation of multicellular organismal process
GO:0000122	0.439	negative regulation of transcription by RNA polymerase II
GO:0050793	0.435	regulation of developmental process
GO:0031325	0.409	positive regulation of cellular metabolic process
GO:0051173	0.370	positive regulation of nitrogen compound metabolic process
GO:0051716	0.369	cellular response to stimulus
GO:0045595	0.362	regulation of cell differentiation
GO:0010557	0.360	positive regulation of macromolecule biosynthetic process
GO:0031328	0.360	positive regulation of cellular biosynthetic process
GO:0045935	0.359	positive regulation of nucleobase-containing compound metabolic process
GO:1903508	0.353	positive regulation of nucleic acid-templated transcription
GO:0042221	0.341	response to chemical
GO:0023051	0.327	regulation of signaling
GO:0010629	0.326	negative regulation of gene expression
GO:0010646	0.325	regulation of cell communication
GO:0045893	0.325	positive regulation of DNA-templated transcription
GO:0022008	0.323	neurogenesis
GO:0065009	0.322	regulation of molecular function
GO:0065008	0.322	regulation of biological quality
GO:2000026	0.317	regulation of multicellular organismal development
GO:0045944	0.303	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.315	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]