StarFunc result for job id Q9Y467

User Input

>input (1007 residues)
MSRRKQRKPQQLISDCEGPSASENGDASEEDHPQVCAKCCAQFTDPTEFLAHQNACSTDP
PVMVIIGGQENPNNSSASSEPRPEGHNNPQVMDTEHSNPPDSGSSVPTDPTWGPERRGEE
SPGHFLVAATGTAAGGGGGLILASPKLGATPLPPESTPAPPPPPPPPPPPGVGSGHLNIP
LILEELRVLQQRQIHQMQMTEQICRQVLLLGSLGQTVGAPASPSELPGTGTASSTKPLLP
LFSPIKPVQTSKTLASSSSSSSSSSGAETPKQAFFHLYHPLGSQHPFSAGGVGRSHKPTP
APSPALPGSTDQLIASPHLAFPSTTGLLAAQCLGAARGLEATASPGLLKPKNGSGELSYG
EVMGPLEKPGGRHKCRFCAKVFGSDSALQIHLRSHTGERPYKCNVCGNRFTTRGNLKVHF
HRHREKYPHVQMNPHPVPEHLDYVITSSGLPYGMSVPPEKAEEEAATPGGGVERKPLVAS
TTALSATESLTLLSTSAGTATAPGLPAFNKFVLMKAVEPKNKADENTPPGSEGSAISGVA
ESSTATRMQLSKLVTSLPSWALLTNHFKSTGSFPFPYVLEPLGASPSETSKLQQLVEKID
RQGAVAVTSAASGAPTTSAPAPSSSASSGPNQCVICLRVLSCPRALRLHYGQHGGERPFK
CKVCGRAFSTRGNLRAHFVGHKASPAARAQNSCPICQKKFTNAVTLQQHVRMHLGGQIPN
GGTALPEGGGAAQENGSEQSTVSGAGSFPQQQSQQPSPEEELSEEEEEEDEEEEEDVTDE
DSLAGRGSESGGEKAISVRGDSEEASGAEEEVGTVAAAATAGKEMDSNEKTTQQSSLPPP
PPPDSLDQPQPMEQGSSGVLGGKEEGGKPERSSSPASALTPEGEATSVTLVEELSLQEAM
RKEPGESSSRKACEVCGQAFPSQAALEEHQKTHPKEGPLFTCVFCRQGFLERATLKKHML
LAHHQVQPFAPHGPQNIAALSLVPGCSPSITSTGLSPFPRKDDPTIP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y467	0.999	0.999	0.000	1007	1.000	1.000	Q9Y467.pdb.gz	SALL2_HUMAN Sal-like protein 2 OS=Homo sapiens OX=9606 GN=SALL2 PE=1 SV=4
2	AFDB:Q62255	0.160	0.126	3.588E-45	1320	0.353	0.269	Q62255.pdb.gz	SALL3_MOUSE Sal-like protein 3 OS=Mus musculus OX=10090 GN=Sall3 PE=1 SV=2
3	AFDB:A0MWC1	0.094	0.088	1.065E-39	1091	0.318	0.293	A0MWC1.pdb.gz	A0MWC1_DANRE Sal-like protein 4 OS=Danio rerio OX=7955 GN=sb:cb372 PE=1 SV=1
4	AFDB:Q64318	0.059	0.054	5.993E-7	1117	0.156	0.141	Q64318.pdb.gz	ZEB1_MOUSE Zinc finger E-box-binding homeobox 1 OS=Mus musculus OX=10090 GN=Zeb1 PE=1 SV=1
5	AFDB:P37275	0.059	0.054	7.781E-7	1124	0.150	0.134	P37275.pdb.gz	ZEB1_HUMAN Zinc finger E-box-binding homeobox 1 OS=Homo sapiens OX=9606 GN=ZEB1 PE=1 SV=2
6	AFDB:Q5A4H5	0.062	0.082	4.536E-6	731	0.089	0.123	Q5A4H5.pdb.gz	CRZ1_CANAL Transcriptional regulator CRZ1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRZ1 PE=1 SV=1
7	AFDB:A2BIH4	0.046	0.041	7.515E-5	1169	0.132	0.114	A2BIH4.pdb.gz	A2BIH4_DANRE Zinc finger protein 644a OS=Danio rerio OX=7955 GN=fi40c02 PE=4 SV=1
8	AFDB:A2A7B5	0.056	0.039	1.874E-4	1709	0.164	0.097	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
9	AFDB:E5RFF3	0.068	0.067	2.960E-4	1035	0.164	0.159	E5RFF3.pdb.gz	E5RFF3_HUMAN Transcriptional repressor GATA binding 1 OS=Homo sapiens OX=9606 GN=TRPS1 PE=1 SV=1
10	AFDB:Q92610	0.059	0.051	3.601E-4	1267	0.172	0.137	Q92610.pdb.gz	ZN592_HUMAN Zinc finger protein 592 OS=Homo sapiens OX=9606 GN=ZNF592 PE=1 SV=2
11	PDB:3w5kB	0.050	0.257	2.497E-2	110	0.024	0.218	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4r8pL	0.023	0.072	2.412	254	0.011	0.043	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
13	PDB:6htsR	0.025	0.231	2.574	72	0.014	0.194	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
14	PDB:7zsb4	0.019	0.053	5.279	306	0.012	0.039	7zsb4.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
15	PDB:1b8tA	0.029	0.079	5.636	192	0.021	0.109	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
16	PDB:6hivA5	0.018	0.226	6.016	55	0.005	0.091	6hivA5.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
17	PDB:4kblA	0.022	0.043	6.422	395	0.007	0.018	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
18	PDB:2p01A	0.033	0.070	7.317	323	0.020	0.062	2p01A.pdb.gz
19	PDB:4kfzB	0.032	0.115	7.317	148	0.021	0.142	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
20	PDB:4v6wCj	0.037	0.192	7.811	92	0.015	0.163	4v6wCj.pdb.gz	Structures of the human and Drosophila 80S ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9QX96	0.0	1594	1004	0.886	0.888	SALL2_MOUSE Sal-like protein 2 OS=Mus musculus OX=10090 GN=Sall2 PE=1 SV=2
2	Q9Y467	0.0	2020	1007	1.000	1.000	SALL2_HUMAN Sal-like protein 2 OS=Homo sapiens OX=9606 GN=SALL2 PE=1 SV=4
3	F1QI36	6.78e-123	408	1313	0.376	0.289	F1QI36_DANRE Sal-like protein 1 OS=Danio rerio OX=7955 GN=cb896spalt PE=1 SV=1
4	A0A1D5NSE4	1.10e-113	381	1217	0.255	0.211	A0A1D5NSE4_DANRE Sal-like protein 1 isoform X1 OS=Danio rerio OX=7955 GN=cb896spalt PE=1 SV=1
5	Q9DF77	1.54e-112	379	1308	0.241	0.186	Q9DF77_CHICK Spalt 1 OS=Gallus gallus OX=9031 GN=SAL1 PE=1 SV=1
6	Q9NSC2	1.44e-109	371	1324	0.254	0.193	SALL1_HUMAN Sal-like protein 1 OS=Homo sapiens OX=9606 GN=SALL1 PE=1 SV=2
7	Q6P5E3	2.48e-109	371	1323	0.321	0.244	Q6P5E3_MOUSE Sal-like 1 (Drosophila) OS=Mus musculus OX=10090 GN=Sall1 PE=1 SV=1
8	Q9ER74	2.90e-108	368	1322	0.252	0.192	SALL1_MOUSE Sal-like protein 1 OS=Mus musculus OX=10090 GN=Sall1 PE=1 SV=1
9	Q90ZW5	4.65e-104	355	1261	0.216	0.173	Q90ZW5_CHICK Spalt 2 protein OS=Gallus gallus OX=9031 GN=SAL2 PE=1 SV=1
10	Q62255	6.30e-102	350	1320	0.213	0.162	SALL3_MOUSE Sal-like protein 3 OS=Mus musculus OX=10090 GN=Sall3 PE=1 SV=2
11	A0MWC1	3.36e-88	308	1091	0.178	0.164	A0MWC1_DANRE Sal-like protein 4 OS=Danio rerio OX=7955 GN=sb:cb372 PE=1 SV=1
12	Q8BX22	4.27e-70	256	1067	0.173	0.163	SALL4_MOUSE Sal-like protein 4 OS=Mus musculus OX=10090 GN=Sall4 PE=1 SV=2
13	Q9UJQ4	7.53e-41	166	1053	0.083	0.080	SALL4_HUMAN Sal-like protein 4 OS=Homo sapiens OX=9606 GN=SALL4 PE=1 SV=1
14	P39770	3.18e-33	141	1365	0.068	0.050	SALM_DROME Homeotic protein spalt-major OS=Drosophila melanogaster OX=7227 GN=salm PE=1 SV=3
15	P91639	2.43e-30	132	1263	0.066	0.052	P91639_DROME Spalt-related protein OS=Drosophila melanogaster OX=7227 GN=salr PE=4 SV=1
16	Q9VKH3	2.70e-30	132	1267	0.057	0.045	Q9VKH3_DROME FI23031p1 OS=Drosophila melanogaster OX=7227 GN=salr PE=2 SV=1
17	Q5U0U1	2.87e-30	132	1267	0.057	0.045	Q5U0U1_DROME AT17006p OS=Drosophila melanogaster OX=7227 GN=salr PE=2 SV=1
18	Q5U0U8	2.87e-30	132	1267	0.057	0.045	Q5U0U8_DROME AT24316p OS=Drosophila melanogaster OX=7227 GN=salr PE=2 SV=1
19	G5EFF4	2.11e-19	96.3	744	0.093	0.126	SEM4_CAEEL Spalt-like protein sem-4 OS=Caenorhabditis elegans OX=6239 GN=sem-4 PE=1 SV=1
20	Q9BYN7	3.61e-17	89.4	854	0.094	0.111	ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens OX=9606 GN=ZNF341 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06397 Desulfoferrod_N	4.7e+02	11.8	Desulfoferrodoxin, N-terminal domain
2	PF06524 NOA36	34	15.2	NOA36 protein
3	PF15750 UBZ_FAAP20	2.1e+02	13.2	Ubiquitin-binding zinc-finger
4	PF00096 zf-C2H2	1.7e-14	64.5	Zinc finger, C2H2 type
5	PF16622 zf-C2H2_11	20	16.4	zinc-finger C2H2-type
6	PF12756 zf-C2H2_2	3.9	19.2	C2H2 type zinc-finger (2 copies)
7	PF13894 zf-C2H2_4	2.8e-18	76.0	C2H2-type zinc finger
8	PF13912 zf-C2H2_6	2.7e-07	41.6	C2H2-type zinc finger
9	PF15909 zf-C2H2_8	2.8	19.7	C2H2-type zinc ribbon
10	PF12171 zf-C2H2_jaz	3.1e-07	41.7	Zinc-finger double-stranded RNA-binding
11	PF05605 zf-Di19	25	16.6	Drought induced 19 protein (Di19), zinc-binding
12	PF13465 zf-H2C2_2	4.6e-08	44.3	Zinc-finger double domain
13	PF12874 zf-met	9.4e-08	43.4	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483562

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000172229	0.940	Tumor necrosis factor receptor superfamily member 16
2	9606.ENSP00000323588	0.855	Transcription factor SOX-2
3	9606.ENSP00000329170	0.750	POU domain, class 3, transcription factor 2
4	9606.ENSP00000477868	0.700	TOX high mobility group box family member 4
5	9606.ENSP00000414558	0.631	Protein ABHD4
6	9606.ENSP00000009041	0.628	STARD3 N-terminal-like protein
7	9606.ENSP00000298717	0.628	N6-adenosine-methyltransferase catalytic subunit
8	9606.ENSP00000250498	0.624	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
9	9606.ENSP00000229307	0.621	Homeobox protein NANOG
10	9606.ENSP00000331040	0.617	Oligodendrocyte transcription factor 2
11	9606.ENSP00000377854	0.611	LIM/homeobox protein Lhx6
12	9606.ENSP00000302437	0.596	Olfactory receptor 10G3
13	9606.ENSP00000382863	0.591	Chromodomain-helicase-DNA-binding protein 8
14	9606.ENSP00000379228	0.585	E3 ubiquitin-protein ligase HECW1
15	9606.ENSP00000199448	0.579	Mammalian ependymin-related protein 1
16	9606.ENSP00000259915	0.568	POU domain, class 5, transcription factor 1
17	9606.ENSP00000374240	0.536	Short stature homeobox protein 2
18	9606.ENSP00000445383	0.516	Olfactory receptor 10G2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001216	0.995	DNA-binding transcription activator activity
GO:0001228	0.938	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0044877	0.597	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.996	developmental process
GO:0019222	0.996	regulation of metabolic process
GO:0032501	0.995	multicellular organismal process
GO:0050794	0.994	regulation of cellular process
GO:0048856	0.988	anatomical structure development
GO:0007275	0.983	multicellular organism development
GO:0080090	0.982	regulation of primary metabolic process
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0060255	0.981	regulation of macromolecule metabolic process
GO:0031323	0.977	regulation of cellular metabolic process
GO:0009889	0.970	regulation of biosynthetic process
GO:0010468	0.970	regulation of gene expression
GO:0019219	0.970	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.963	regulation of macromolecule biosynthetic process
GO:0031326	0.963	regulation of cellular biosynthetic process
GO:0006355	0.949	regulation of DNA-templated transcription
GO:0048731	0.917	system development
GO:0048518	0.900	positive regulation of biological process
GO:0006357	0.868	regulation of transcription by RNA polymerase II
GO:0048522	0.841	positive regulation of cellular process
GO:0009893	0.709	positive regulation of metabolic process
GO:0010604	0.698	positive regulation of macromolecule metabolic process
GO:0048519	0.696	negative regulation of biological process
GO:0048513	0.696	animal organ development
GO:0051173	0.667	positive regulation of nitrogen compound metabolic process
GO:0031325	0.665	positive regulation of cellular metabolic process
GO:0048523	0.660	negative regulation of cellular process
GO:0009987	0.643	cellular process
GO:0010557	0.635	positive regulation of macromolecule biosynthetic process
GO:0031328	0.635	positive regulation of cellular biosynthetic process
GO:0051254	0.630	positive regulation of RNA metabolic process
GO:0045893	0.610	positive regulation of DNA-templated transcription
GO:0045944	0.414	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005654	0.986	nucleoplasm
GO:0005737	0.645	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]