StarFunc result for job id Q9Y468

User Input

>input (840 residues)
MHLVAGDSPGSGPHLPATAFIIPASSATLGLPSSALDVSCFPREPIHVGAPEQVAGCEPV
SATVLPQLSAGPASSSTSTVRLLEWTEAAAPPPGGGLRFRISEYKPLNMAGVEQPPSPEL
RQEGVTEYEDGGAPAGDGEAGPQQAEDHPQNPPEDPNQDPPEDDSTCQCQACGPHQAAGP
DLGSSNDGCPQLFQERSVIVENSSGSTSASELLKPMKKRKRREYQSPSEEESEPEAMEKQ
EEGKDPEGQPTASTPESEEWSSSQPATGEKKECWSWESYLEEQKAITAPVSLFQDSQAVT
HNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHP
AGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLE
AVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTP
PQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVE
DVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSASPGGCP
PLSYRSLPHTRTSKYSFHHRKCPTPGCDGSGHVTGKFTAHHCLSGCPLAERNQSRLKAEL
SDSEASARKKNLSGFSPRKKPRHHGRIGRPPKYRKIPQEDFQTLTPDVVHQSLFMSALSA
HPDRSLSVCWEQHCKLLPGVAGISASTVAKWTIDEVFGFVQTLTGCEDQARLFKDEARIV
RVTHVSGKTLVWTVAQLGDLVCSDHLQEGKGILETGVHSLLCSLPTHLLAKLSFASDSQY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y468	1.000	1.000	0.000	840	1.000	1.000	Q9Y468.pdb.gz	LMBL1_HUMAN Lethal(3)malignant brain tumor-like protein 1 OS=Homo sapiens OX=9606 GN=L3MBTL1 PE=1 SV=4
2	AFDB:Q96JM7	0.403	0.433	5.376E-62	780	0.343	0.369	Q96JM7.pdb.gz	LMBL3_HUMAN Lethal(3)malignant brain tumor-like protein 3 OS=Homo sapiens OX=9606 GN=L3MBTL3 PE=1 SV=2
3	AFDB:B1AVB3	0.210	0.183	7.845E-16	969	0.135	0.117	B1AVB3.pdb.gz	B1AVB3_MOUSE Scm polycomb group protein like 2 OS=Mus musculus OX=10090 GN=Scml2 PE=1 SV=1
4	AFDB:Q90WE3	0.057	0.032	5.901E-4	1905	0.115	0.051	Q90WE3.pdb.gz	TDRD6_XENLA Tudor domain-containing 6-like OS=Xenopus laevis OX=8355 GN=tdrd6 PE=1 SV=1
5	AFDB:Q12888	0.069	0.039	1.224E-3	1972	0.123	0.052	Q12888.pdb.gz	TP53B_HUMAN TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2
6	AFDB:A0A2R8Q8E2	0.048	0.042	5.577E-3	1069	0.136	0.107	A0A2R8Q8E2.pdb.gz
7	PDB:3mp8A	0.070	0.100	5.941E-3	513	0.035	0.057	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
8	AFDB:Q9VWK5	0.046	0.030	1.224E-2	1513	0.143	0.079	Q9VWK5.pdb.gz	Q9VWK5_DROME GH15225p OS=Drosophila melanogaster OX=7227 GN=Ulp1 PE=1 SV=1
9	PDB:2ns2A	0.069	0.217	1.727E-2	201	0.032	0.134	2ns2A.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
10	AFDB:Q24459	0.063	0.051	3.180E-2	1043	0.131	0.105	Q24459.pdb.gz	PCL_DROME Polycomb protein Pcl OS=Drosophila melanogaster OX=7227 GN=Pcl PE=1 SV=2
11	AFDB:Q7YSI9	0.048	0.027	4.711E-2	1654	0.180	0.091	Q7YSI9.pdb.gz	UNC53_CAEEL Adapter protein unc-53 OS=Caenorhabditis elegans OX=6239 GN=unc-53 PE=1 SV=1
12	AFDB:Q8SZS0	0.049	0.047	4.711E-2	952	0.108	0.096	Q8SZS0.pdb.gz	Q8SZS0_DROME LD31046p OS=Drosophila melanogaster OX=7227 GN=SKIP PE=2 SV=1
13	PDB:7okyZ	0.078	0.136	5.939E-2	374	0.032	0.072	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
14	PDB:6tedZ	0.072	0.106	1.543E-1	510	0.032	0.053	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
15	PDB:2lqnA	0.057	0.112	1.931E-1	303	0.040	0.112	2lqnA.pdb.gz
16	PDB:4v8mBU	0.058	0.268	2.705E-1	158	0.023	0.120	4v8mBU.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
17	PDB:6r8yK	0.053	0.054	3.788E-1	825	0.029	0.029	6r8yK.pdb.gz	DNA damage detection in nucleosomes involves DNA register shifting.
18	PDB:7ajtUR	0.052	0.076	3.788E-1	482	0.038	0.066	7ajtUR.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
19	PDB:7r1dC	0.061	0.220	4.007E-1	192	0.014	0.062	7r1dC.pdb.gz
20	PDB:3tk9A	0.062	0.145	4.483E-1	226	0.030	0.111	3tk9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NA19	0.0	555	623	0.345	0.465	LMBL4_HUMAN Lethal(3)malignant brain tumor-like protein 4 OS=Homo sapiens OX=9606 GN=L3MBTL4 PE=1 SV=2
2	Q96JM7	0.0	553	780	0.379	0.408	LMBL3_HUMAN Lethal(3)malignant brain tumor-like protein 3 OS=Homo sapiens OX=9606 GN=L3MBTL3 PE=1 SV=2
3	Q9Y468	0.0	1733	840	1.000	1.000	LMBL1_HUMAN Lethal(3)malignant brain tumor-like protein 1 OS=Homo sapiens OX=9606 GN=L3MBTL1 PE=1 SV=4
4	Q8BLB7	2.91e-164	501	883	0.313	0.298	LMBL3_MOUSE Lethal(3)malignant brain tumor-like protein 3 OS=Mus musculus OX=10090 GN=L3mbtl3 PE=1 SV=1
5	Q9VB52	5.19e-86	302	1477	0.188	0.107	Q9VB52_DROME LD05287p OS=Drosophila melanogaster OX=7227 GN=l(3)mbt PE=1 SV=1
6	O76931	5.29e-86	301	1477	0.188	0.107	O76931_DROME Tumor-supressor protein OS=Drosophila melanogaster OX=7227 GN=l(3)mbt PE=2 SV=1
7	Q969R5	1.09e-50	192	705	0.144	0.172	LMBL2_HUMAN Lethal(3)malignant brain tumor-like protein 2 OS=Homo sapiens OX=9606 GN=L3MBTL2 PE=1 SV=1
8	P59178	5.59e-50	190	703	0.143	0.171	LMBL2_MOUSE Lethal(3)malignant brain tumor-like protein 2 OS=Mus musculus OX=10090 GN=L3mbtl2 PE=1 SV=2
9	Q6P5G3	2.16e-47	181	631	0.145	0.193	MBTD1_MOUSE MBT domain-containing protein 1 OS=Mus musculus OX=10090 GN=Mbtd1 PE=1 SV=1
10	Q05BQ5	2.26e-47	181	628	0.145	0.194	MBTD1_HUMAN MBT domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MBTD1 PE=1 SV=2
11	A0A571BDL9	9.05e-46	170	367	0.114	0.262	A0A571BDL9_MOUSE Scm polycomb group protein like 2 (Fragment) OS=Mus musculus OX=10090 GN=Scml2 PE=1 SV=1
12	Q9UQR0	9.96e-46	177	700	0.111	0.133	SCML2_HUMAN Sex comb on midleg-like protein 2 OS=Homo sapiens OX=9606 GN=SCML2 PE=1 SV=1
13	Q9VK33	4.17e-45	178	1220	0.129	0.089	SMBT_DROME Polycomb protein Sfmbt OS=Drosophila melanogaster OX=7227 GN=Sfmbt PE=1 SV=2
14	Q96GD3	6.01e-43	168	660	0.107	0.136	SCMH1_HUMAN Polycomb protein SCMH1 OS=Homo sapiens OX=9606 GN=SCMH1 PE=1 SV=1
15	B1AVB1	1.14e-42	169	825	0.114	0.116	B1AVB1_MOUSE Scm polycomb group protein like 2 OS=Mus musculus OX=10090 GN=Scml2 PE=1 SV=1
16	B1AVB2	1.34e-42	169	827	0.114	0.116	B1AVB2_MOUSE Scm polycomb group protein like 2 OS=Mus musculus OX=10090 GN=Scml2 PE=1 SV=1
17	Q8K214	5.75e-42	166	706	0.106	0.126	SCMH1_MOUSE Polycomb protein SCMH1 OS=Mus musculus OX=10090 GN=Scmh1 PE=1 SV=1
18	B1AVB4	8.61e-42	167	845	0.102	0.102	B1AVB4_MOUSE Scm polycomb group protein like 2 OS=Mus musculus OX=10090 GN=Scml2 PE=1 SV=1
19	E9Q796	9.83e-42	167	901	0.102	0.095	E9Q796_MOUSE Scm polycomb group protein like 2 OS=Mus musculus OX=10090 GN=Scml2 PE=1 SV=1
20	Q8BYC8	9.94e-42	166	845	0.102	0.102	Q8BYC8_MOUSE Scm polycomb group protein-like 2 OS=Mus musculus OX=10090 GN=Scml2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02820 MBT	1.7e-92	315.1	mbt repeat
2	PF01530 zf-C2HC	7.7e-11	53.2	Zinc finger, C2HC type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000398516

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.992	Cellular tumor antigen p53
2	9606.ENSP00000367034	0.981	Histone cluster 1 H4 family member c
3	9606.ENSP00000384629	0.953	N-lysine methyltransferase KMT5A
4	9606.ENSP00000244537	0.948	Histone cluster 1 H4 family member f
5	9606.ENSP00000336687	0.942	Chromobox protein homolog 3
6	9606.ENSP00000347168	0.904	Histone cluster 1 H4 family member j
7	9606.ENSP00000366956	0.904	Histone cluster 1 H4 family member h
8	9606.ENSP00000366974	0.904	Histone cluster 1 H4 family member b
9	9606.ENSP00000443017	0.904	Histone cluster 4, H4
10	9606.ENSP00000462355	0.904	Histone cluster 2 H4 family member b
11	9606.ENSP00000462667	0.904	Histone cluster 2 H4 family member a
12	9606.ENSP00000479106	0.904	Histone cluster 1 H4 family member a
13	9606.ENSP00000479461	0.904	Histone cluster 1 H4 family member d
14	9606.ENSP00000479794	0.904	Histone cluster 1 H4 family member k
15	9606.ENSP00000480960	0.904	Histone cluster 1 H4 family member l
16	9606.ENSP00000481486	0.904	Histone cluster 1 H4 family member i
17	9606.ENSP00000484789	0.904	Histone H4
18	9606.ENSP00000307705	0.884	Histone H1.4
19	9606.ENSP00000269397	0.805	E3 SUMO-protein ligase CBX4
20	9606.ENSP00000355924	0.750	N-lysine methyltransferase SMYD2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0019904	1.000	protein domain specific binding
GO:0031491	1.000	nucleosome binding
GO:0035064	1.000	methylated histone binding
GO:0097159	0.789	organic cyclic compound binding
GO:1901363	0.788	heterocyclic compound binding
GO:0003676	0.724	nucleic acid binding
GO:0003677	0.620	DNA binding
GO:0032093	0.573	SAM domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0048519	0.985	negative regulation of biological process
GO:0031323	0.984	regulation of cellular metabolic process
GO:0010468	0.978	regulation of gene expression
GO:0010605	0.977	negative regulation of macromolecule metabolic process
GO:0006325	0.955	chromatin organization
GO:0019219	0.931	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.929	negative regulation of cellular process
GO:0031326	0.925	regulation of cellular biosynthetic process
GO:0006355	0.924	regulation of DNA-templated transcription
GO:0051172	0.922	negative regulation of nitrogen compound metabolic process
GO:0045892	0.914	negative regulation of DNA-templated transcription
GO:0051726	0.714	regulation of cell cycle
GO:0006338	0.676	chromatin remodeling
GO:0032502	0.632	developmental process
GO:0050793	0.595	regulation of developmental process
GO:0060284	0.565	regulation of cell development
GO:0048856	0.465	anatomical structure development
GO:0071704	0.411	organic substance metabolic process
GO:0044238	0.353	primary metabolic process
GO:0043170	0.352	macromolecule metabolic process
GO:0006807	0.348	nitrogen compound metabolic process
GO:0051239	0.329	regulation of multicellular organismal process
GO:0051128	0.326	regulation of cellular component organization
GO:0048869	0.303	cellular developmental process
GO:0070828	0.301	heterochromatin organization
GO:0010629	0.301	negative regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.998	protein-containing complex
GO:0005694	0.995	chromosome
GO:0140513	0.962	nuclear protein-containing complex
GO:0000785	0.954	chromatin
GO:0005677	0.760	chromatin silencing complex
GO:0061793	0.390	chromatin lock complex
GO:0005737	0.358	cytoplasm
GO:0000793	0.334	condensed chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]