StarFunc result for job id Q9Y483

User Input

>input (593 residues)
MRDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQDVLARWSDGL
FYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMV
ICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQ
TLPYSVADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLF
GDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENW
DRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEIKKKKHLFGLRIRVPPVPPNVAFK
AEKEPEGTSHEFKIKGRKASKPISDSREVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAEP
LLDKESISENPTLDLPCSIGRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSR
KRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDEGKEDYQFDELNTEILNNLAD
QELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q02395	0.781	0.781	2.662E-101	593	0.976	0.976	Q02395.pdb.gz	MTF2_MOUSE Metal-response element-binding transcription factor 2 OS=Mus musculus OX=10090 GN=Mtf2 PE=1 SV=2
2	AFDB:A0A2R8RZV0	0.092	0.060	1.377E-2	1059	0.133	0.075	A0A2R8RZV0.pdb.gz
3	AFDB:A8MW92	0.098	0.059	1.543E-2	1017	0.113	0.066	A8MW92.pdb.gz	P20L1_HUMAN PHD finger protein 20-like protein 1 OS=Homo sapiens OX=9606 GN=PHF20L1 PE=1 SV=2
4	AFDB:O54826	0.096	0.061	1.939E-2	1068	0.148	0.082	O54826.pdb.gz	AF10_MOUSE Protein AF-10 OS=Mus musculus OX=10090 GN=Mllt10 PE=1 SV=2
5	AFDB:A0A0B4KGP1	0.104	0.047	4.313E-2	1717	0.111	0.038	A0A0B4KGP1.pdb.gz	A0A0B4KGP1_DROME Alhambra, isoform P OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
6	PDB:5z8lA	0.083	0.217	4.929E-2	204	0.046	0.132	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
7	PDB:7r1dC	0.080	0.238	4.929E-2	192	0.013	0.042	7r1dC.pdb.gz
8	AFDB:B1AR10	0.100	0.062	5.119E-2	1109	0.120	0.064	B1AR10.pdb.gz	B1AR10_MOUSE Myeloid/lymphoid or mixed-lineage leukemia; translocated to, 6 OS=Mus musculus OX=10090 GN=Mllt6 PE=1 SV=1
9	PDB:1zq1A	0.075	0.099	6.943E-2	437	0.024	0.032	1zq1A.pdb.gz	Structural Basis for tRNA-Dependent Amidotransferase Function
10	PDB:7nkxZ	0.075	0.269	7.351E-2	156	0.015	0.058	7nkxZ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
11	AFDB:A0A024R8E2	0.104	0.064	8.082E-2	1130	0.138	0.073	A0A024R8E2.pdb.gz
12	PDB:6tedZ	0.075	0.087	8.240E-2	510	0.027	0.031	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
13	PDB:3mp8A	0.090	0.104	8.724E-2	513	0.019	0.021	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
14	PDB:3p8bB	0.090	0.335	9.779E-2	147	0.015	0.061	3p8bB.pdb.gz	RNA polymerase and transcription elongation factor Spt4/5 complex structure.
15	PDB:4pa0A	0.074	0.046	1.096E-1	974	0.012	0.007	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
16	PDB:4pa0B	0.072	0.047	1.161E-1	920	0.012	0.008	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
17	PDB:4zn3A	0.086	0.322	1.229E-1	147	0.012	0.048	4zn3A.pdb.gz	Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
18	AFDB:F4JW79	0.084	0.035	3.005E-1	1493	0.120	0.048	F4JW79.pdb.gz	RDM3_ARATH Protein RNA-directed DNA methylation 3 OS=Arabidopsis thaliana OX=3702 GN=RDM3 PE=1 SV=1
19	AFDB:P42684	0.103	0.061	3.776E-1	1182	0.128	0.064	P42684.pdb.gz	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
20	AFDB:O13606	0.113	0.127	4.745E-1	517	0.071	0.081	O13606.pdb.gz	MEI4_SCHPO Meiosis-specific transcription factor mei4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mei4 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4DZG1	0.0	1032	491	0.828	1.000	B4DZG1_HUMAN Metal response element binding transcription factor 2, isoform CRA_c OS=Homo sapiens OX=9606 GN=MTF2 PE=1 SV=1
2	Q02395	0.0	1212	593	0.976	0.976	MTF2_MOUSE Metal-response element-binding transcription factor 2 OS=Mus musculus OX=10090 GN=Mtf2 PE=1 SV=2
3	Q9Y483	0.0	1242	593	1.000	1.000	MTF2_HUMAN Metal-response element-binding transcription factor 2 OS=Homo sapiens OX=9606 GN=MTF2 PE=1 SV=3
4	Q5T6S3	3.90e-161	474	580	0.449	0.459	PHF19_HUMAN PHD finger protein 19 OS=Homo sapiens OX=9606 GN=PHF19 PE=1 SV=1
5	Q9CXG9	6.54e-160	471	578	0.444	0.455	PHF19_MOUSE PHD finger protein 19 OS=Mus musculus OX=10090 GN=Phf19 PE=1 SV=1
6	O43189	1.42e-129	393	567	0.322	0.337	PHF1_HUMAN PHD finger protein 1 OS=Homo sapiens OX=9606 GN=PHF1 PE=1 SV=3
7	A0A1U9X8A3	4.15e-129	388	457	0.300	0.389	A0A1U9X8A3_HUMAN PHF1 OS=Homo sapiens OX=9606 PE=3 SV=1
8	Q5XI49	5.83e-129	386	412	0.300	0.432	Q5XI49_RAT PHD finger protein 1 OS=Rattus norvegicus OX=10116 GN=Phf1 PE=1 SV=1
9	Q6MGC9	7.07e-129	391	560	0.322	0.341	Q6MGC9_RAT PHD finger protein 1 OS=Rattus norvegicus OX=10116 GN=Phf1 PE=3 SV=1
10	Q9Z1B8	1.79e-128	390	559	0.300	0.318	PHF1_MOUSE PHD finger protein 1 OS=Mus musculus OX=10090 GN=Phf1 PE=1 SV=2
11	A0A0G2K557	6.41e-128	390	600	0.300	0.297	A0A0G2K557_RAT PHD finger protein 1 OS=Rattus norvegicus OX=10116 GN=Phf1 PE=3 SV=1
12	Q24459	1.20e-49	187	1043	0.185	0.105	PCL_DROME Polycomb protein Pcl OS=Drosophila melanogaster OX=7227 GN=Pcl PE=1 SV=2
13	F7ELX2	1.29e-25	107	239	0.086	0.213	F7ELX2_RAT PHD finger protein 1 OS=Rattus norvegicus OX=10116 GN=Phf1 PE=4 SV=1
14	Q55AQ4	2.11e-18	92.0	988	0.071	0.043	Q55AQ4_DICDI B30.2/SPRY domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271754 PE=4 SV=1
15	P87233	4.15e-09	61.6	461	0.039	0.050	PHF1_SCHPO SWM histone demethylase complex subunit phf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=phf1 PE=1 SV=1
16	Q09908	1.60e-08	59.7	538	0.046	0.050	PHF2_SCHPO SWM histone demethylase complex subunit phf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=phf2 PE=1 SV=1
17	O60070	2.63e-07	56.2	652	0.056	0.051	ASH2_SCHPO Set1 complex component ash2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ash2 PE=3 SV=1
18	Q9VBB3	8.37e-07	53.5	328	0.042	0.076	INT12_DROME Integrator complex subunit 12 OS=Drosophila melanogaster OX=7227 GN=IntS12 PE=1 SV=1
19	Q9H8E8	4.12e-06	52.4	782	0.051	0.038	CSR2B_HUMAN Cysteine-rich protein 2-binding protein OS=Homo sapiens OX=9606 GN=KAT14 PE=1 SV=3
20	Q803A0	1.66e-05	50.4	829	0.067	0.048	JADE1_DANRE Protein Jade-1 OS=Danio rerio OX=7955 GN=jade1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	53	15.1	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF07039 DUF1325	1.8e+02	13.6	SGF29 tudor-like domain
3	PF15057 DUF4537	10	17.5	Domain of unknown function (DUF4537)
4	PF14061 Mtf2_C	1.1e-24	97.6	Polycomb-like MTF2 factor 2
5	PF00628 PHD	6.6e-13	59.7	PHD-finger
6	PF14446 Prok-RING_1	0.89	20.9	Prokaryotic RING finger family 1
7	PF18104 Tudor_2	8.5e-11	52.7	Jumonji domain-containing protein 2A Tudor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359321

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316578	0.997	Polycomb protein SUZ12
2	9606.ENSP00000320147	0.995	Histone-lysine N-methyltransferase EZH2
3	9606.ENSP00000341280	0.993	Protein Jumonji
4	9606.ENSP00000263360	0.989	Polycomb protein EED
5	9606.ENSP00000404658	0.979	Histone-lysine N-methyltransferase EZH1
6	9606.ENSP00000369424	0.958	Histone-binding protein RBBP7
7	9606.ENSP00000362592	0.929	Histone-binding protein RBBP4
8	9606.ENSP00000381840	0.909	Zinc finger protein AEBP2
9	9606.ENSP00000484710	0.877	Scaffold protein that serves as a bridging partner between the PRC2/EED-EZH2 complex and the elongin BC complex: required to fine- tune the transcriptional status of Polycomb group (PcG) target genes in embryonic stem cells (ESCs). Plays a key role in genomic regions that display both active and repressive chromatin properties in pluripotent stem cells by sustaining low level expression at PcG target genes: acts by recruiting the elongin BC complex, thereby restricting excessive activity of the PRC2/EED-EZH2 complex. Interaction with USP7 promotes deubiquitination of H2B at promoter si [...]
10	9606.ENSP00000269397	0.829	E3 SUMO-protein ligase CBX4
11	9606.ENSP00000360138	0.797	Ligand-dependent corepressor
12	9606.ENSP00000245185	0.764	Metallothionein-2
13	9606.ENSP00000233630	0.751	Polycomb group RING finger protein 1
14	9606.ENSP00000420294	0.723	Polyhomeotic-like protein 3
15	9606.ENSP00000352516	0.707	DNA (cytosine-5)-methyltransferase 1
16	9606.ENSP00000296417	0.706	Histone H2A.Z
17	9606.ENSP00000328547	0.704	DNA (cytosine-5)-methyltransferase 3B
18	9606.ENSP00000308405	0.699	Histone H2A.V
19	9606.ENSP00000269385	0.697	Chromobox protein homolog 8
20	9606.ENSP00000380692	0.695	Lysine-specific demethylase 7A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035064	0.999	methylated histone binding
GO:0003676	0.975	nucleic acid binding
GO:0003677	0.935	DNA binding
GO:0001217	0.912	DNA-binding transcription repressor activity
GO:0043565	0.912	sequence-specific DNA binding
GO:0003690	0.910	double-stranded DNA binding
GO:0000981	0.905	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.896	transcription cis-regulatory region binding
GO:0001227	0.894	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000977	0.889	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019222	0.985	regulation of metabolic process
GO:0050794	0.983	regulation of cellular process
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0009987	0.981	cellular process
GO:0080090	0.975	regulation of primary metabolic process
GO:0045892	0.973	negative regulation of DNA-templated transcription
GO:0051247	0.960	positive regulation of protein metabolic process
GO:0032502	0.959	developmental process
GO:0031062	0.949	positive regulation of histone methylation
GO:0006357	0.939	regulation of transcription by RNA polymerase II
GO:0048856	0.827	anatomical structure development
GO:0032501	0.826	multicellular organismal process
GO:0000122	0.819	negative regulation of transcription by RNA polymerase II
GO:0019827	0.779	stem cell population maintenance
GO:0050896	0.736	response to stimulus
GO:0030154	0.664	cell differentiation
GO:0048863	0.599	stem cell differentiation
GO:0051716	0.461	cellular response to stimulus
GO:0007275	0.437	multicellular organism development
GO:0031057	0.316	negative regulation of histone modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.994	protein-containing complex
GO:0005737	0.981	cytoplasm
GO:0031519	0.947	PcG protein complex
GO:1902494	0.943	catalytic complex
GO:1990234	0.926	transferase complex
GO:0035098	0.725	ESC/E(Z) complex
GO:0005829	0.337	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]