StarFunc result for job id Q9Y484

User Input

>input (360 residues)
MTQQPLRGVTSLRFNQDQSCFCCAMETGVRIYNVEPLMEKGHLDHEQVGSMGLVEMLHRS
NLLALVGGGSSPKFSEISVLIWDDAREGKDSKEKLVLEFTFTKPVLSVRMRHDKIVIVLK
NRIYVYSFPDNPRKLFEFDTRDNPKGLCDLCPSLEKQLLVFPGHKCGSLQLVDLASTKPG
TSSAPFTINAHQSDIACVSLNQPGTVVASASQKGTLIRLFDTQSKEKLVELRRGTDPATL
YCINFSHDSSFLCASSDKGTVHIFALKDTRLNRRSALARVGKVGPMIGQYVDSQWSLASF
TVPAESACICAFGRNTSKNVNSVIAICVDGTFHKYVFTPDGNCNREAFDVYLDICDDDDF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y484	1.000	1.000	5.150E-75	360	1.000	1.000	Q9Y484.pdb.gz	WIPI4_HUMAN WD repeat domain phosphoinositide-interacting protein 4 OS=Homo sapiens OX=9606 GN=WDR45 PE=1 SV=1
2	AFDB:Q5MNZ6	0.884	0.924	1.271E-42	344	0.464	0.485	Q5MNZ6.pdb.gz	WIPI3_HUMAN WD repeat domain phosphoinositide-interacting protein 3 OS=Homo sapiens OX=9606 GN=WDR45B PE=1 SV=2
3	AFDB:Q54SA0	0.852	0.875	5.414E-39	350	0.372	0.383	Q54SA0.pdb.gz	Q54SA0_DICDI WD repeat domain phosphoinositide-interacting protein 3 OS=Dictyostelium discoideum OX=44689 GN=wdr45l PE=4 SV=1
4	PDB:6iyyA	0.780	0.896	4.875E-37	312	0.442	0.510	6iyyA.pdb.gz
5	AFDB:Q93VB2	0.835	0.710	3.324E-35	425	0.353	0.299	Q93VB2.pdb.gz	AT18A_ARATH Autophagy-related protein 18a OS=Arabidopsis thaliana OX=3702 GN=ATG18A PE=1 SV=1
6	AFDB:Q86MP3	0.842	0.783	2.662E-32	388	0.311	0.289	Q86MP3.pdb.gz	EPG6_CAEEL Ectopic P granules protein 6 OS=Caenorhabditis elegans OX=6239 GN=epg-6 PE=1 SV=1
7	PDB:6kybB	0.797	0.868	1.275E-29	330	0.289	0.315	6kybB.pdb.gz
8	AFDB:A0A024R8L5	0.803	0.653	2.627E-29	446	0.256	0.206	A0A024R8L5.pdb.gz
9	AFDB:O16466	0.791	0.695	2.627E-29	412	0.261	0.228	O16466.pdb.gz	ATG18_CAEEL Autophagy-related protein 18 OS=Caenorhabditis elegans OX=6239 GN=atg-18 PE=1 SV=1
10	AFDB:P43601	0.789	0.576	4.666E-29	500	0.306	0.220	P43601.pdb.gz	ATG18_YEAST Autophagy-related protein 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG18 PE=1 SV=1
11	AFDB:P50079	0.793	0.644	4.666E-29	448	0.297	0.239	P50079.pdb.gz	HSV2_YEAST SVP1-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSV2 PE=1 SV=1
12	AFDB:M9PER1	0.806	0.655	7.087E-29	447	0.239	0.192	M9PER1.pdb.gz	M9PER1_DROME Autophagy-related 18a, isoform E OS=Drosophila melanogaster OX=7227 GN=Atg18a PE=1 SV=1
13	PDB:7mq8LR	0.552	0.281	1.458E-12	773	0.147	0.069	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:5wyjBA	0.390	0.195	1.796E-12	755	0.147	0.070	5wyjBA.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
15	PDB:7mqaLQ	0.277	0.136	2.332E-12	830	0.167	0.072	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7ajtUA	0.434	0.209	2.457E-12	834	0.161	0.070	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	PDB:5mzhB	0.599	0.528	2.728E-12	415	0.128	0.111	5mzhB.pdb.gz
18	PDB:7mq8LO	0.582	0.270	3.362E-12	848	0.136	0.058	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7jvrB	0.579	0.607	6.985E-12	342	0.131	0.137	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
20	PDB:5nnzA	0.565	0.601	1.307E-11	335	0.103	0.110	5nnzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y484	0.0	748	360	1.000	1.000	WIPI4_HUMAN WD repeat domain phosphoinositide-interacting protein 4 OS=Homo sapiens OX=9606 GN=WDR45 PE=1 SV=1
2	Q5MNZ6	9.92e-111	328	344	0.461	0.483	WIPI3_HUMAN WD repeat domain phosphoinositide-interacting protein 3 OS=Homo sapiens OX=9606 GN=WDR45B PE=1 SV=2
3	Q54SA0	3.98e-76	240	350	0.389	0.400	Q54SA0_DICDI WD repeat domain phosphoinositide-interacting protein 3 OS=Dictyostelium discoideum OX=44689 GN=wdr45l PE=4 SV=1
4	Q93VB2	8.04e-67	218	425	0.353	0.299	AT18A_ARATH Autophagy-related protein 18a OS=Arabidopsis thaliana OX=3702 GN=ATG18A PE=1 SV=1
5	Q86MP3	3.85e-52	179	388	0.311	0.289	EPG6_CAEEL Ectopic P granules protein 6 OS=Caenorhabditis elegans OX=6239 GN=epg-6 PE=1 SV=1
6	Q9P3W2	1.21e-46	164	364	0.247	0.245	HSV2_SCHPO SVP1-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hsv2 PE=3 SV=1
7	P50079	3.99e-41	151	448	0.306	0.246	HSV2_YEAST SVP1-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSV2 PE=1 SV=1
8	O16466	3.68e-33	129	412	0.275	0.240	ATG18_CAEEL Autophagy-related protein 18 OS=Caenorhabditis elegans OX=6239 GN=atg-18 PE=1 SV=1
9	Q9HDZ7	4.39e-31	123	373	0.283	0.273	ATG18_SCHPO Autophagy-related protein 18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg18 PE=1 SV=1
10	Q8R3E3	1.27e-25	108	446	0.194	0.157	WIPI1_MOUSE WD repeat domain phosphoinositide-interacting protein 1 OS=Mus musculus OX=10090 GN=Wipi1 PE=1 SV=1
11	M9PHS3	3.69e-25	106	372	0.203	0.196	M9PHS3_DROME Autophagy-related 18a, isoform F OS=Drosophila melanogaster OX=7227 GN=Atg18a PE=1 SV=1
12	Q9VSF0	3.83e-25	106	377	0.203	0.194	Q9VSF0_DROME Autophagy-related 18a, isoform A OS=Drosophila melanogaster OX=7227 GN=Atg18a PE=1 SV=2
13	Q5MNZ9	4.80e-25	107	446	0.175	0.141	WIPI1_HUMAN WD repeat domain phosphoinositide-interacting protein 1 OS=Homo sapiens OX=9606 GN=WIPI1 PE=1 SV=3
14	M9PEY7	9.86e-25	106	435	0.200	0.166	M9PEY7_DROME Autophagy-related 18a, isoform D OS=Drosophila melanogaster OX=7227 GN=Atg18a PE=1 SV=1
15	M9PER1	1.05e-24	106	447	0.203	0.163	M9PER1_DROME Autophagy-related 18a, isoform E OS=Drosophila melanogaster OX=7227 GN=Atg18a PE=1 SV=1
16	Q9P6N1	2.81e-23	100	335	0.208	0.224	MG179_SCHPO Autophagy-related protein 21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug179 PE=1 SV=1
17	Q80W47	2.82e-23	102	445	0.211	0.171	WIPI2_MOUSE WD repeat domain phosphoinositide-interacting protein 2 OS=Mus musculus OX=10090 GN=Wipi2 PE=1 SV=1
18	Q9Y4P8	3.16e-21	96.7	454	0.156	0.123	WIPI2_HUMAN WD repeat domain phosphoinositide-interacting protein 2 OS=Homo sapiens OX=9606 GN=WIPI2 PE=1 SV=1
19	P43601	9.18e-20	92.4	500	0.142	0.102	ATG18_YEAST Autophagy-related protein 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG18 PE=1 SV=1
20	Q9VIE1	1.69e-19	91.7	471	0.225	0.172	Q9VIE1_DROME Autophagy-related 18b, isoform A OS=Drosophila melanogaster OX=7227 GN=Atg18b PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	2.7	19.7	Anaphase-promoting complex subunit 4 WD40 domain
2	PF03178 CPSF_A	65	14.3	CPSF A subunit region
3	PF20426 NBCH_WD40	2e+02	12.2	Neurobeachin beta propeller domain
4	PF00400 WD40	7.6e-06	37.8	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000009107

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000003668	0.883	Autophagy related 2A
2	60711.ENSCSAP00000006787	0.868	Autophagy related 2B
3	60711.ENSCSAP00000010943	0.705	Ubiquitin-like protein involved in autophagic vesicle formation
4	60711.ENSCSAP00000006129	0.702	E1-like activating enzyme involved in the 2 ubiquitin-like systems required for cytoplasm to vacuole transport (Cvt) and autophagy. Activates ATG12 for its conjugation with ATG5 as well as the ATG8 family proteins for their conjugation with phosphatidylethanolamine. Both systems are needed for the ATG8 association to Cvt vesicles and autophagosomes membranes. Required for autophagic death induced by caspase-8 inhibition. Required for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy req [...]
5	60711.ENSCSAP00000004474	0.687	Involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation. Plays a key role in the organization of the preautophagosomal structure/phagophore assembly site (PAS), the nucleating site for formation of the sequestering vesicle.
6	60711.ENSCSAP00000010869	0.659	Involved in autophagic vesicle formation.
7	60711.ENSCSAP00000010955	0.648	DDB1 and CUL4 associated factor 17
8	60711.ENSCSAP00000001181	0.640	Chromosome 19 open reading frame 12
9	60711.ENSCSAP00000002135	0.632	Autophagy related 101
10	60711.ENSCSAP00000013980	0.600	Ectopic P-granules autophagy protein 5 homolog (C. elegans)
11	60711.ENSCSAP00000013962	0.586	Phosphatidylinositol 3-kinase, catalytic subunit type 3
12	60711.ENSCSAP00000013680	0.565	WD repeat domain, phosphoinositide interacting 2
13	60711.ENSCSAP00000009097	0.560	Pantothenate kinase 2
14	60711.ENSCSAP00000006403	0.559	Tectonin beta-propeller repeat containing 2
15	60711.ENSCSAP00000010831	0.550	RB1-inducible coiled-coil 1
16	60711.ENSCSAP00000010805	0.538	WD repeat domain 48
17	60711.ENSCSAP00000002656	0.537	Autophagy related 16-like 1 (S. cerevisiae)
18	60711.ENSCSAP00000014129	0.529	OTU deubiquitinase 7B
19	60711.ENSCSAP00000000591	0.518	WD repeat domain, phosphoinositide interacting 1
20	60711.ENSCSAP00000004082	0.517	Unc-51 like autophagy activating kinase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0032266	0.999	phosphatidylinositol-3-phosphate binding
GO:0019899	0.997	enzyme binding
GO:0019901	0.853	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007154	0.987	cell communication
GO:0051716	0.987	cellular response to stimulus
GO:0065007	0.986	biological regulation
GO:0050794	0.977	regulation of cellular process
GO:0016236	0.969	macroautophagy
GO:0048518	0.962	positive regulation of biological process
GO:1905037	0.951	autophagosome organization
GO:0048522	0.938	positive regulation of cellular process
GO:0000045	0.913	autophagosome assembly
GO:0009267	0.850	cellular response to starvation
GO:0033043	0.755	regulation of organelle organization
GO:0031323	0.715	regulation of cellular metabolic process
GO:0010506	0.653	regulation of autophagy
GO:0031331	0.524	positive regulation of cellular catabolic process
GO:0044088	0.436	regulation of vacuole organization
GO:0044087	0.412	regulation of cellular component biogenesis
GO:0010508	0.348	positive regulation of autophagy
GO:0016241	0.340	regulation of macroautophagy
GO:1902115	0.332	regulation of organelle assembly
GO:0016239	0.328	positive regulation of macroautophagy
GO:2000785	0.324	regulation of autophagosome assembly
GO:1902117	0.324	positive regulation of organelle assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000407	0.998	phagophore assembly site
GO:0043231	0.956	intracellular membrane-bounded organelle
GO:0005829	0.895	cytosol
GO:0005634	0.344	nucleus
GO:0012505	0.333	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]