StarFunc result for job id Q9Y485

User Input

>input (1400 residues)
MNLHQVLTGAVNPGDHCFSVGSIGDQRFTAYASGCDIVILGSDFERLQIIPGAKHGNIQV
GCVDCSMQQGKIAASYGNVISIFEPVNLPKQKKNLELYSQWQKSGQFFLESIAHNITWDP
TGSRLLTGSSYLQLWSNTNLEKPTEDENLNKTDLNFGDWKCIWHCKTASQVHLMKFSPDG
EFFATAGKDDCLLKVWYNVENWRTAVTSPDGSSEKQSQGEIDFSFVYLAHPRAVNGFSWR
KTSKYMPRASVCNVLLTCCKDNVCRLWVETFLPNDCLLYGGDCSHWTESINLTNNFKRNA
SSKERVQNALEVNLRHFRRGRRRSLALVAHTGYLPHQQDPHHVHRNTPLHANALCHFHIA
ASINPATDIPLLPSITSLSLNENEEKTGPFVVHWLNNKELHFTLSMEVFLQQLRKSFEQP
SSEASVEDSNQADVKSDEETDDGVDDLKINPEKKELGCDKMVPNSSFTSLSSAAIDHQIE
VLLSEWSKNADMLFSIHPMDGSLLVWHVDWLDEYQPGMFRQVQVSFVSRIPVAFPTGDAN
SLCKSIMMYACTKNVDLAIQQGKQKPSGLTRSTSMLISSGHNKSSNSLKLSIFTPNVMMI
SKHADGSLNQWLVSFAEESAFSTVLSISHKSRYCGHRFHLNDLACHSVLPLLLTTSHHNA
LRTPDVDNPEQPFDALNIEECSLTQQNKSTVDVAFQDPSAVYSELILWRVDPVGPLSFSG
GVSELARINSLHVSAFSNVAWLPTLIPSYCLGAYCNSPSACFVASDGQYLRLYEAVIDAK
KLLSELSNPEISKYVGEVFNIVSQQSTARPGCIIALDPITKLHGRKTQLLHVFEEDFILN
NLEKKSLGKDSILSNAGSSPNGFSEKFYLIVIECTQDNRSLLHMWNLHLKSIPVSLDEKV
DTKLSEAVWQPEEHYSSSPEKILSPFSQKYQACRANLQSTSRLTLFSEMVYSQELHLPEG
VEIISIKPSAGHLSSSSIYPACSAPYLLATSCSDEKVRFWRCRVTDGESATSKNGKIDLA
YIWEEWPLLIEDGLQSNSSITVPGRPVEVSCAHTNRLAVAYKQPASNSRSSQDFVMHVSI
FECESTGGSCWVLEQTIHLDELSTVLDSGISVDSNLVAYNKQDMYLSSKENITSNTKHLV
HLDWMSREDGSHILTVGIGSKLFMYGPLAGKVQDQTGKETLAFPLWESTKVVPLSKFVLL
RSVDLVSSVDGSPPFPVSLSWVRDGILVVGMDCEMHVYCQWQPSSKQEPVITDSYSGSTP
SITSLIKQSNSSSGLHPPKKTLTRSMTSLAQKICGKKTAFDPSVDMEDSGLFEAAHVLSP
TLPQYHPLQLLELMDLGKVRRAKAILSHLVKCIAGEVVALNEAESNHERRLRSLTISASG
STTRDPQAFNKAENTDYTEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5m2nA	0.322	0.556	1.074E-15	711	0.082	0.162	5m2nA.pdb.gz
2	PDB:6qk7B	0.321	0.541	9.118E-15	749	0.084	0.158	6qk7B.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
3	PDB:7mq8LR	0.212	0.320	1.455E-12	773	0.076	0.138	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
4	PDB:6jp6A	0.133	0.167	7.146E-12	998	0.096	0.134	6jp6A.pdb.gz
5	PDB:7mqaLQ	0.201	0.308	1.118E-11	830	0.084	0.141	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
6	PDB:6lqsB1	0.243	0.369	6.064E-11	806	0.084	0.145	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
7	PDB:7mq8LO	0.234	0.348	6.373E-11	848	0.076	0.125	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
8	PDB:7mqaLO	0.240	0.365	7.399E-11	819	0.076	0.129	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
9	PDB:7mq8LT	0.223	0.334	9.971E-11	869	0.066	0.107	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
10	PDB:7d5sBE	0.232	0.346	1.279E-10	865	0.058	0.094	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
11	AFDB:Q49HI2	0.183	0.228	1.154E-8	1058	0.111	0.147	Q49HI2.pdb.gz	Q49HI2_CAEEL Tomosyn OS=Caenorhabditis elegans OX=6239 GN=tom-1 PE=2 SV=1
12	AFDB:Q57VP9	0.104	0.060	5.312E-7	2653	0.090	0.047	Q57VP9.pdb.gz	Q57VP9_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O4.100 PE=4 SV=1
13	AFDB:Q229Z6	0.123	0.246	3.515E-6	634	0.046	0.103	Q229Z6.pdb.gz	POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTHERM_01308010 PE=3 SV=1
14	AFDB:F8W3V6	0.107	0.123	1.563E-5	1193	0.064	0.075	F8W3V6.pdb.gz
15	AFDB:X1WHY6	0.090	0.093	2.701E-5	1360	0.138	0.142	X1WHY6.pdb.gz	AMR1B_DANRE Activating molecule in BECN1-regulated autophagy protein 1B OS=Danio rerio OX=7955 GN=ambra1b PE=2 SV=1
16	AFDB:Q8SY41	0.119	0.143	7.675E-5	1122	0.098	0.122	Q8SY41.pdb.gz	BCAS3_DROME Breast carcinoma-amplified sequence 3 homolog OS=Drosophila melanogaster OX=7227 GN=rudhira PE=1 SV=1
17	AFDB:M9PHU0	0.117	0.082	1.974E-4	2263	0.083	0.051	M9PHU0.pdb.gz	M9PHU0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG12432 PE=1 SV=1
18	AFDB:E7FAG6	0.094	0.099	4.833E-4	1315	0.123	0.131	E7FAG6.pdb.gz	AMR1A_DANRE Activating molecule in BECN1-regulated autophagy protein 1A OS=Danio rerio OX=7955 GN=ambra1a PE=2 SV=2
19	AFDB:P59438	0.122	0.148	1.243E-3	1126	0.016	0.020	P59438.pdb.gz	HPS5_MOUSE BLOC-2 complex member HPS5 OS=Mus musculus OX=10090 GN=Hps5 PE=1 SV=2
20	AFDB:F1QM29	0.105	0.104	4.101E-3	1413	0.104	0.103	F1QM29.pdb.gz	F1QM29_DANRE Retinitis pigmentosa GTPase regulator b OS=Danio rerio OX=7955 GN=rpgrb PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZMW1	0.0	1503	3035	0.567	0.262	A0A8I5ZMW1_RAT Dmx-like 2 OS=Rattus norvegicus OX=10116 GN=Dmxl2 PE=1 SV=1
2	B2RWN7	0.0	2911	3048	1.000	0.459	B2RWN7_HUMAN DMXL1 protein OS=Homo sapiens OX=9606 GN=DMXL1 PE=1 SV=1
3	F1M3W5	0.0	1503	3056	0.567	0.260	F1M3W5_RAT Dmx-like 2 OS=Rattus norvegicus OX=10116 GN=Dmxl2 PE=1 SV=3
4	Q8BPN8	0.0	1506	3032	0.569	0.263	DMXL2_MOUSE DmX-like protein 2 OS=Mus musculus OX=10090 GN=Dmxl2 PE=1 SV=3
5	Q8TDJ6	0.0	1510	3036	0.570	0.263	DMXL2_HUMAN DmX-like protein 2 OS=Homo sapiens OX=9606 GN=DMXL2 PE=1 SV=2
6	U5U756	0.0	1442	3050	0.564	0.259	U5U756_DANRE DmX-like protein 2 OS=Danio rerio OX=7955 GN=Rbcn3a PE=1 SV=1
7	Q9W425	6.93e-130	448	3426	0.214	0.088	Q9W425_DROME Rabconnectin-3A OS=Drosophila melanogaster OX=7227 GN=Rbcn-3A PE=1 SV=3
8	Q24593	1.25e-129	447	3429	0.214	0.087	Q24593_DROME Uncharacterized protein DmX OS=Drosophila melanogaster OX=7227 GN=Rbcn-3A PE=4 SV=1
9	P47104	1.51e-13	78.6	1357	0.044	0.045	RAV1_YEAST Regulator of V-ATPase in vacuolar membrane protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAV1 PE=1 SV=1
10	Q9VU68	0.008	43.1	608	0.021	0.049	WDR1_DROME Actin-interacting protein 1 OS=Drosophila melanogaster OX=7227 GN=flr PE=2 SV=1
11	Q8W4D0	0.10	39.3	631	0.028	0.062	CPY71_ARATH Peptidyl-prolyl cis-trans isomerase CYP71 OS=Arabidopsis thaliana OX=3702 GN=CYP71 PE=1 SV=1
12	X1WET9	0.26	38.1	681	0.033	0.068	X1WET9_DANRE Eukaryotic translation initiation factor 3 subunit B OS=Danio rerio OX=7955 GN=eif3b PE=1 SV=1
13	Q9AV81	0.95	36.2	527	0.021	0.057	PRP19_ORYSJ Pre-mRNA-processing factor 19 OS=Oryza sativa subsp. japonica OX=39947 GN=PRP19 PE=2 SV=1
14	P25635	1.0	36.2	923	0.020	0.030	PWP2_YEAST Periodic tryptophan protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PWP2 PE=1 SV=2
15	Q11176	1.1	36.2	611	0.019	0.044	WDR1_CAEEL Actin-interacting protein 1 OS=Caenorhabditis elegans OX=6239 GN=unc-78 PE=1 SV=1
16	Q9Z1Z2	1.9	35.0	350	0.014	0.057	STRAP_MOUSE Serine-threonine kinase receptor-associated protein OS=Mus musculus OX=10090 GN=Strap PE=1 SV=2
17	Q9Y3F4	2.1	35.0	350	0.014	0.057	STRAP_HUMAN Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1
18	Q6LA54	2.5	35.0	933	0.023	0.034	YF48_SCHPO Uncharacterized WD repeat-containing protein C3H5.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3H5.08c PE=1 SV=2
19	Q8H1S7	3.4	34.7	927	0.020	0.030	JMJ28_ARATH Lysine-specific demethylase JMJ28 OS=Arabidopsis thaliana OX=3702 GN=JMJ28 PE=1 SV=1
20	Q9UUG8	4.1	34.3	598	0.013	0.030	TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tup12 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12234 Rav1p_C	2.7e-05	34.4	RAVE protein 1 C terminal
2	PF00400 WD40	23	17.2	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000439479

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000234396	0.931	V-type proton ATPase subunit B, kidney isoform
2	9606.ENSP00000272238	0.906	V-type proton ATPase subunit C 2
3	9606.ENSP00000231487	0.836	S-phase kinase-associated protein 1
4	9606.ENSP00000351575	0.825	Transcription factor TFIIIB component B'' homolog
5	9606.ENSP00000322832	0.774	Protein rogdi homolog
6	9606.ENSP00000254442	0.734	WD repeat-containing protein 7
7	9606.ENSP00000411418	0.734	Rab3 GTPase-activating protein catalytic subunit
8	9606.ENSP00000430774	0.731	Uncharacterized protein
9	9606.ENSP00000232978	0.715	NK-tumor recognition protein
10	9606.ENSP00000351832	0.695	Rab3 GTPase-activating protein non-catalytic subunit
11	9606.ENSP00000273398	0.692	V-type proton ATPase catalytic subunit A
12	9606.ENSP00000367542	0.682	Tropomyosin beta chain
13	9606.ENSP00000484713	0.681	WASH complex subunit 4
14	9606.ENSP00000275034	0.663	PH-interacting protein
15	9606.ENSP00000377250	0.646	Protein MON2 homolog
16	9606.ENSP00000326603	0.641	Structural maintenance of chromosomes flexible hinge domain-containing protein 1
17	9606.ENSP00000239587	0.638	Probable tubulin polyglutamylase TTLL2
18	9606.ENSP00000276390	0.627	V-type proton ATPase subunit B, brain isoform
19	9606.ENSP00000359645	0.621	RNA-binding motif protein, X chromosome
20	9606.ENSP00000379784	0.616	Cytochrome c oxidase subunit 7B2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.950	cellular process
GO:0065007	0.889	biological regulation
GO:0032502	0.877	developmental process
GO:0050789	0.851	regulation of biological process
GO:0048522	0.811	positive regulation of cellular process
GO:0048856	0.475	anatomical structure development
GO:0032879	0.354	regulation of localization
GO:0048513	0.319	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0099503	0.997	secretory vesicle
GO:0030054	0.600	cell junction
GO:0005634	0.555	nucleus
GO:0045202	0.510	synapse
GO:0098793	0.478	presynapse
GO:0030133	0.449	transport vesicle
GO:0008021	0.419	synaptic vesicle
GO:0032991	0.323	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]