StarFunc result for job id Q9Y490

User Input

>input (2541 residues)
MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEAPAGPPSDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIG
ITNHDEYSLVRELMEEKKEEITGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLED
EGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDT
DPHFQDALMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACT
KVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNE
LLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMA
TNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASTPKASAGPQPLLVQSCKAVA
EQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQL
SQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLEKDLQEVKAAARDGKLKPLP
GETMEKCTQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGLRSLAQAARGVAA
LTSDPAVQAIVLDTASDVLDKASSLIEEAKKAAGHPGDPESQQRLAQVAKAVTQALNRCV
SCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAATELVQAS
RGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAK
ALSTDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRELLENP
VQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGDAISTASKALCGFTEAA
AQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAK
HTSALCNSCRLASARTTNPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTEENRAQCRA
ATAPLLEAVDNLSAFASNPEFSSIPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARAL
AVNPRDPPSWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASL
AAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLANAARAEASQLGHKVSQMAQYFEP
LTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAV
QMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRT
AKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASEAKPAAVAAENEEIGSHIKHRV
QELGHGCAALVTKAGALQCSPSDAYTKKELIECARRVSEKVSHVLAALQAGNRGTQACIT
AASAVSGIIADLDTTIMFATAGTLNREGTETFADHREGILKTAKVLVEDTKVLVQNAAGS
QEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKA
AAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVF
CSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACK
EAAYHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPSPELKQQLTGHSKRVAGSV
TELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLN
FEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMV
AAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAG
NAVKRASDNLVKAAQKAAAFEEQENETVVVKEKMVGGIAQIIAAQEEMLRKERELEEARK
KLAQIRQQQYKFLPSELRDEH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6r9tA	0.530	0.608	0.000	2185	0.859	0.999	6r9tA.pdb.gz
2	AFDB:A0A0R4IDZ8	0.549	0.548	0.000	2544	0.830	0.829	A0A0R4IDZ8.pdb.gz
3	AFDB:A0A3G2LGI8	0.881	0.884	0.000	2531	0.537	0.539	A0A3G2LGI8.pdb.gz	TLN_OSCPE Talin OS=Oscarella pearsei OX=1940113 GN=TLN PE=1 SV=1
4	AFDB:G3V852	0.534	0.534	0.000	2541	0.986	0.986	G3V852.pdb.gz	G3V852_RAT Talin 1 OS=Rattus norvegicus OX=10116 GN=Tln1 PE=1 SV=1
5	AFDB:G5EGK1	0.566	0.564	0.000	2553	0.377	0.376	G5EGK1.pdb.gz	G5EGK1_CAEEL FERM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tln-1 PE=1 SV=1
6	AFDB:P54939	0.545	0.545	0.000	2541	0.890	0.890	P54939.pdb.gz	TLN1_CHICK Talin-1 OS=Gallus gallus OX=9031 GN=TLN1 PE=1 SV=2
7	AFDB:Q71LX4	0.375	0.399	0.000	2375	0.712	0.761	Q71LX4.pdb.gz	TLN2_MOUSE Talin-2 OS=Mus musculus OX=10090 GN=Tln2 PE=1 SV=3
8	AFDB:Q9Y4G6	0.551	0.551	0.000	2542	0.762	0.762	Q9Y4G6.pdb.gz	TLN2_HUMAN Talin-2 OS=Homo sapiens OX=9606 GN=TLN2 PE=1 SV=4
9	AFDB:Q54K81	0.211	0.208	2.017E-94	2614	0.256	0.249	Q54K81.pdb.gz	TALB_DICDI Talin-B OS=Dictyostelium discoideum OX=44689 GN=talB PE=2 SV=1
10	AFDB:P0CE95	0.174	0.177	9.123E-86	2492	0.228	0.232	P0CE95.pdb.gz	TALA1_DICDI Talin-A OS=Dictyostelium discoideum OX=44689 GN=talA PE=1 SV=1
11	AFDB:M9PF06	0.154	0.683	6.722E-38	513	0.115	0.571	M9PF06.pdb.gz	M9PF06_DROME Rhea, isoform I OS=Drosophila melanogaster OX=7227 GN=rhea PE=1 SV=1
12	PDB:7c3mA	0.123	0.491	4.465E-11	577	0.036	0.158	7c3mA.pdb.gz
13	PDB:6xz4A	0.100	0.608	6.165E-10	304	0.029	0.243	6xz4A.pdb.gz
14	PDB:4rm8A	0.101	0.603	1.462E-9	368	0.023	0.160	4rm8A.pdb.gz
15	PDB:1tr2B	0.084	0.144	6.384E-7	1029	0.064	0.158	1tr2B.pdb.gz
16	PDB:6nr7A	0.073	0.125	8.415E-7	1086	0.063	0.148	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
17	PDB:4iggB	0.059	0.136	5.249E-6	771	0.039	0.127	4iggB.pdb.gz
18	PDB:6bfiB	0.059	0.140	8.514E-6	806	0.045	0.143	6bfiB.pdb.gz
19	PDB:6fuyA	0.056	0.121	7.001E-5	961	0.058	0.153	6fuyA.pdb.gz
20	PDB:6yvaC	0.042	0.420	1.779E-4	155	0.011	0.181	6yvaC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A3G2LGI8	2458	2531	0.543	0.545	TLN_OSCPE Talin OS=Oscarella pearsei OX=1940113 GN=TLN PE=1 SV=1
2	A0A8I6ABG6	5101	2558	0.986	0.980	A0A8I6ABG6_RAT Talin 1 OS=Rattus norvegicus OX=10116 GN=Tln1 PE=1 SV=1
3	G3V852	5116	2541	0.986	0.986	G3V852_RAT Talin 1 OS=Rattus norvegicus OX=10116 GN=Tln1 PE=1 SV=1
4	G4S9F5	933	1890	0.257	0.346	G4S9F5_CAEEL I/LWEQ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tln-1 PE=1 SV=1
5	G5EGK1	1538	2553	0.386	0.385	G5EGK1_CAEEL FERM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tln-1 PE=1 SV=1
6	M9NDM3	1856	2169	0.388	0.455	M9NDM3_DROME Rhea, isoform C OS=Drosophila melanogaster OX=7227 GN=rhea PE=1 SV=1
7	M9PBW9	2197	2815	0.477	0.430	M9PBW9_DROME Rhea, isoform G OS=Drosophila melanogaster OX=7227 GN=rhea PE=1 SV=1
8	M9PEJ8	2210	2689	0.477	0.451	M9PEJ8_DROME Rhea, isoform H OS=Drosophila melanogaster OX=7227 GN=rhea PE=1 SV=1
9	M9PF06	612	513	0.116	0.577	M9PF06_DROME Rhea, isoform I OS=Drosophila melanogaster OX=7227 GN=rhea PE=1 SV=1
10	P26039	5126	2541	0.987	0.987	TLN1_MOUSE Talin-1 OS=Mus musculus OX=10090 GN=Tln1 PE=1 SV=2
11	P54939	4500	2541	0.891	0.891	TLN1_CHICK Talin-1 OS=Gallus gallus OX=9031 GN=TLN1 PE=1 SV=2
12	Q3B7U7	769	386	0.150	0.990	Q3B7U7_RAT Tln1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Tln1 PE=2 SV=1
13	Q498D4	2996	1552	0.586	0.960	Q498D4_RAT Tln1 protein OS=Rattus norvegicus OX=10116 GN=Tln1 PE=2 SV=1
14	Q5U7N6	4239	2538	0.830	0.831	Q5U7N6_DANRE Talin-1 OS=Danio rerio OX=7955 GN=sb:cb854 PE=1 SV=1
15	Q71LX4	3593	2375	0.715	0.765	TLN2_MOUSE Talin-2 OS=Mus musculus OX=10090 GN=Tln2 PE=1 SV=3
16	Q95XN3	722	996	0.163	0.416	Q95XN3_CAEEL FERM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tln-1 PE=1 SV=1
17	Q960C2	1071	1601	0.239	0.379	Q960C2_DROME SD07967p OS=Drosophila melanogaster OX=7227 GN=rhea PE=2 SV=1
18	Q9VSL8	2206	2836	0.477	0.427	Q9VSL8_DROME Rhea, isoform B OS=Drosophila melanogaster OX=7227 GN=rhea PE=1 SV=1
19	Q9Y490	5182	2541	1.000	1.000	TLN1_HUMAN Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3
20	Q9Y4G6	3865	2542	0.762	0.762	TLN2_HUMAN Talin-2 OS=Homo sapiens OX=9606 GN=TLN2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00887 ACBP	1.8	20.3	Acyl CoA binding protein
2	PF13602 ADH_zinc_N_2	4.5e+02	13.3	Zinc-binding dehydrogenase
3	PF11227 DUF3025	2.7e+02	12.8	Protein of unknown function (DUF3025)
4	PF16511 FERM_f0	6.2e-32	121.1	N-terminal or F0 domain of Talin-head FERM
5	PF00373 FERM_M	1.4e-20	85.2	FERM central domain
6	PF09379 FERM_N	0.0045	28.2	FERM N-terminal domain
7	PF12205 GIT1_C	22	16.7	G protein-coupled receptor kinase-interacting protein 1 C term
8	PF02174 IRS	1.7	19.8	PTB domain (IRS-1 type)
9	PF01608 I_LWEQ	3e-58	207.7	I/LWEQ domain
10	PF00788 RA	1.7e+02	14.2	Ras association (RalGDS/AF-6) domain
11	PF09141 Talin_middle	5.3e-56	200.6	Talin, middle domain
12	PF06242 TrcR	5.5	18.5	Transcriptional cell cycle regulator TrcR
13	PF08913 VBS	2.6e-62	220.3	Vinculin Binding Site

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000316029

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000211998	0.999	Vinculin
2	9606.ENSP00000379350	0.998	Integrin beta-1
3	9606.ENSP00000452786	0.998	Integrin beta-3
4	9606.ENSP00000267257	0.997	Paxillin
5	9606.ENSP00000365411	0.997	Amyloid beta A4 precursor protein-binding family B member 1-interacting protein
6	9606.ENSP00000466363	0.996	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
7	9606.ENSP00000341189	0.988	Focal adhesion kinase 1
8	9606.ENSP00000377941	0.979	Alpha-actinin-1
9	9606.ENSP00000293379	0.977	Integrin alpha-5
10	9606.ENSP00000380948	0.977	Integrin beta-2
11	9606.ENSP00000362680	0.974	Proto-oncogene tyrosine-protein kinase Src
12	9606.ENSP00000324422	0.973	Zyxin
13	9606.ENSP00000358866	0.972	Filamin-A
14	9606.ENSP00000252699	0.966	Alpha-actinin-4
15	9606.ENSP00000427687	0.963	WD repeat-containing protein 1
16	9606.ENSP00000261023	0.957	Integrin alpha-V
17	9606.ENSP00000295006	0.957	Calpain-2 catalytic subunit
18	9606.ENSP00000250559	0.955	Ras-related protein Rap-1b
19	9606.ENSP00000400175	0.954	Transforming protein RhoA
20	9606.ENSP00000391669	0.953	Breast cancer anti-estrogen resistance protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005178	1.000	integrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0009987	0.996	cellular process
GO:0044085	0.990	cellular component biogenesis
GO:0016043	0.988	cellular component organization
GO:0050896	0.983	response to stimulus
GO:0022607	0.978	cellular component assembly
GO:0034329	0.961	cell junction assembly
GO:0006996	0.958	organelle organization
GO:0050789	0.956	regulation of biological process
GO:0050794	0.953	regulation of cellular process
GO:0032501	0.939	multicellular organismal process
GO:0045216	0.918	cell-cell junction organization
GO:0051716	0.884	cellular response to stimulus
GO:0098609	0.859	cell-cell adhesion
GO:0007154	0.852	cell communication
GO:0023052	0.794	signaling
GO:0007010	0.791	cytoskeleton organization
GO:0007165	0.732	signal transduction
GO:0034109	0.703	homotypic cell-cell adhesion
GO:0065008	0.688	regulation of biological quality
GO:0030029	0.683	actin filament-based process
GO:0006950	0.661	response to stress
GO:0007043	0.648	cell-cell junction assembly
GO:0032502	0.642	developmental process
GO:0050878	0.627	regulation of body fluid levels
GO:0042060	0.627	wound healing
GO:0048856	0.626	anatomical structure development
GO:0007596	0.599	blood coagulation
GO:0007229	0.578	integrin-mediated signaling pathway
GO:0030168	0.573	platelet activation
GO:0070527	0.532	platelet aggregation
GO:0030036	0.524	actin cytoskeleton organization
GO:0007275	0.460	multicellular organism development
GO:0030154	0.431	cell differentiation
GO:0019222	0.411	regulation of metabolic process
GO:0048519	0.384	negative regulation of biological process
GO:0060255	0.349	regulation of macromolecule metabolic process
GO:0048523	0.326	negative regulation of cellular process
GO:0080090	0.325	regulation of primary metabolic process
GO:0051171	0.319	regulation of nitrogen compound metabolic process
GO:0009653	0.307	anatomical structure morphogenesis
GO:0009888	0.302	tissue development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005925	0.996	focal adhesion
GO:0005829	0.968	cytosol
GO:0031982	0.904	vesicle
GO:0005576	0.873	extracellular region
GO:0043231	0.415	intracellular membrane-bounded organelle
GO:0071944	0.405	cell periphery
GO:1903561	0.396	extracellular vesicle
GO:0005886	0.390	plasma membrane
GO:0070062	0.328	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]