StarFunc result for job id Q9Y496

User Input

>input (699 residues)
MPINKSEKPESCDNVKVVVRCRPLNEREKSMCYKQAVSVDEMRGTITVHKTDSSNEPPKT
FTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAIPELR
GIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVY
IKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGIDGNMH
VRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNS
KLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALL
RQFQKEIEELKKKLEEGEEISGSDISGSEEDDDEEGEVGEDGEKRKKRRGKKKVSPDKMI
EMQAKIDEERKALETKLDMEEEERNKARAELEKREKDLLKAQQEHQSLLEKLSALEKKVI
VGGVDLLAKAEEQEKLLEESNMELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQ
GKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPRDY
QEMIENYVHWNEDIGEWQLKCVAYTGNNMRKQTPVPDKKEKDPFEVDLSHVYLAYTEESL
RQSLMKLERPRTSKGKARPKTGRRKRSAKPETVIDSLLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QGI2	0.874	0.871	0.000	702	0.926	0.922	A0A2R8QGI2.pdb.gz
2	AFDB:F1LQZ3	0.876	0.872	0.000	702	0.981	0.977	F1LQZ3.pdb.gz	F1LQZ3_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=1 SV=3
3	AFDB:P46872	0.879	0.879	3.420E-97	699	0.712	0.712	P46872.pdb.gz	KRP85_STRPU Kinesin-II 85 kDa subunit OS=Strongylocentrotus purpuratus OX=7668 GN=KRP85 PE=1 SV=1
4	AFDB:Q9VRK9	0.778	0.803	4.680E-81	677	0.567	0.585	Q9VRK9.pdb.gz	Q9VRK9_DROME Kinesin-like protein OS=Drosophila melanogaster OX=7227 GN=Klp64D PE=3 SV=1
5	AFDB:P46871	0.795	0.750	1.506E-75	742	0.495	0.466	P46871.pdb.gz	KRP95_STRPU Kinesin-II 95 kDa subunit OS=Strongylocentrotus purpuratus OX=7668 GN=KRP95 PE=1 SV=1
6	AFDB:F1QN54	0.790	0.716	5.596E-74	775	0.505	0.455	F1QN54.pdb.gz	KIF3B_DANRE Kinesin-like protein KIF3B OS=Danio rerio OX=7955 GN=kif3b PE=2 SV=1
7	AFDB:Q965T6	0.620	0.669	3.174E-71	646	0.518	0.560	Q965T6.pdb.gz	KLP20_CAEEL Kinesin-like protein klp-20 OS=Caenorhabditis elegans OX=6239 GN=klp-20 PE=1 SV=1
8	AFDB:D3ZI07	0.658	0.617	1.021E-70	747	0.501	0.469	D3ZI07.pdb.gz	D3ZI07_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3b PE=3 SV=1
9	AFDB:P46869	0.727	0.652	1.841E-69	786	0.469	0.417	P46869.pdb.gz	FLA10_CHLRE Kinesin-like protein FLA10 OS=Chlamydomonas reinhardtii OX=3055 GN=FLA10 PE=1 SV=1
10	AFDB:O35066	0.486	0.427	6.546E-66	796	0.455	0.399	O35066.pdb.gz	KIF3C_MOUSE Kinesin-like protein KIF3C OS=Mus musculus OX=10090 GN=Kif3c PE=1 SV=3
11	PDB:7wrgA	0.459	0.398	2.582E-34	812	0.225	0.193	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
12	PDB:7wrgB	0.446	0.401	2.416E-31	783	0.212	0.189	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
13	PDB:4h1gA	0.391	0.407	3.375E-26	670	0.169	0.176	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
14	PDB:5j6hA	0.055	0.108	2.345E-2	275	0.014	0.036	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
15	PDB:6yufA	0.088	0.149	4.833E-2	384	0.050	0.091	6yufA.pdb.gz	A Structure-Based Mechanism for DNA Entry into the Cohesin Ring.
16	PDB:5nj5A	0.060	0.075	6.037E-2	480	0.029	0.042	5nj5A.pdb.gz	The Origins of Specificity in the Microcin-Processing Protease TldD/E.
17	PDB:7d4yB	0.075	0.084	6.037E-2	601	0.039	0.045	7d4yB.pdb.gz
18	PDB:5kynA	0.089	0.086	7.542E-2	730	0.053	0.051	5kynA.pdb.gz	TANGO1/cTAGE5 receptor as a polyvalent template for assembly of large COPII coats.
19	PDB:5njbB	0.054	0.072	7.973E-2	445	0.041	0.065	5njbB.pdb.gz	The Origins of Specificity in the Microcin-Processing Protease TldD/E.
20	PDB:7w85A	0.090	0.134	1.053E-1	435	0.031	0.051	7w85A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JUD6	1410	701	0.979	0.976	A0A0G2JUD6_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=1 SV=2
2	A0A8I6AL48	1390	684	0.960	0.981	A0A8I6AL48_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=3 SV=1
3	A0A8I6AP89	1384	686	0.957	0.975	A0A8I6AP89_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=3 SV=1
4	A0A8I6GCQ1	1368	674	0.944	0.979	A0A8I6GCQ1_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=3 SV=1
5	D3ZI07	636	747	0.496	0.465	D3ZI07_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3b PE=3 SV=1
6	E9QB71	1245	701	0.920	0.917	E9QB71_DANRE Kinesin-like protein OS=Danio rerio OX=7955 GN=fc55h04 PE=1 SV=1
7	F1LQZ3	1407	726	0.981	0.945	F1LQZ3_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=1 SV=3
8	F1QN54	601	775	0.461	0.415	KIF3B_DANRE Kinesin-like protein KIF3B OS=Danio rerio OX=7955 GN=kif3b PE=2 SV=1
9	O14782	545	793	0.433	0.382	KIF3C_HUMAN Kinesin-like protein KIF3C OS=Homo sapiens OX=9606 GN=KIF3C PE=1 SV=4
10	O15066	635	747	0.494	0.462	KIF3B_HUMAN Kinesin-like protein KIF3B OS=Homo sapiens OX=9606 GN=KIF3B PE=1 SV=1
11	O35066	544	796	0.429	0.377	KIF3C_MOUSE Kinesin-like protein KIF3C OS=Mus musculus OX=10090 GN=Kif3c PE=1 SV=3
12	O55165	545	796	0.429	0.377	KIF3C_RAT Kinesin-like protein KIF3C OS=Rattus norvegicus OX=10116 GN=Kif3c PE=2 SV=1
13	P28741	1406	701	0.977	0.974	KIF3A_MOUSE Kinesin-like protein KIF3A OS=Mus musculus OX=10090 GN=Kif3a PE=1 SV=2
14	P46869	607	786	0.496	0.441	FLA10_CHLRE Kinesin-like protein FLA10 OS=Chlamydomonas reinhardtii OX=3055 GN=FLA10 PE=1 SV=1
15	P46871	632	742	0.476	0.449	KRP95_STRPU Kinesin-II 95 kDa subunit OS=Strongylocentrotus purpuratus OX=7668 GN=KRP95 PE=1 SV=1
16	P46872	989	699	0.715	0.715	KRP85_STRPU Kinesin-II 85 kDa subunit OS=Strongylocentrotus purpuratus OX=7668 GN=KRP85 PE=1 SV=1
17	Q19633	541	782	0.423	0.379	Q19633_CAEEL Kinesin-like protein OS=Caenorhabditis elegans OX=6239 GN=klp-11 PE=1 SV=2
18	Q61771	636	747	0.498	0.466	KIF3B_MOUSE Kinesin-like protein KIF3B OS=Mus musculus OX=10090 GN=Kif3b PE=1 SV=1
19	Q965T6	687	646	0.529	0.573	KLP20_CAEEL Kinesin-like protein klp-20 OS=Caenorhabditis elegans OX=6239 GN=klp-20 PE=1 SV=1
20	Q9VRK9	762	677	0.572	0.591	Q9VRK9_DROME Kinesin-like protein OS=Drosophila melanogaster OX=7227 GN=Klp64D PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	5.5e+02	12.2	AAA domain
2	PF00225 Kinesin	1e-118	407.7	Kinesin motor domain
3	PF16796 Microtub_bd	5.1e-23	93.2	Microtubule binding
4	PF05970 PIF1	37	14.9	PIF1-like helicase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9402.XP_006923209.1

Rank	PPI partner	STRING score	Description
1	9402.XP_006907977.1	0.989	Kinesin-associated protein 3
2	9402.XP_006918322.1	0.988	X-linked retinitis pigmentosa GTPase regulator
3	9402.XP_006921773.1	0.970	Kinesin family member 3B
4	9402.XP_006921490.1	0.968	Zinc finger protein GLI2
5	9402.XP_006925464.1	0.968	Zinc finger protein GLI3
6	9402.XP_006922335.1	0.966	Beta-arrestin-2
7	9402.XP_006909010.1	0.964	Zinc finger protein GLI1
8	9402.XP_006926687.1	0.944	Beta-arrestin-1
9	9402.XP_006904904.1	0.881	Intraflagellar transport protein 88 homolog
10	9402.XP_006925052.1	0.862	Intraflagellar transport protein 20 homolog isoform X1
11	9402.XP_006910353.1	0.859	Kinesin-like protein KIF3C
12	9402.XP_006910590.1	0.852	Smoothened like protein
13	9402.XP_006910397.1	0.847	Intraflagellar transport protein 172 homolog
14	9402.XP_006905508.1	0.818	Intraflagellar transport protein 57 homolog
15	9402.XP_006910081.1	0.815	Intraflagellar transport protein 81 homolog
16	9402.XP_006908248.1	0.814	Intraflagellar transport protein 80 homolog
17	9402.XP_006920965.1	0.800	SUFU negative regulator of hedgehog signaling
18	9402.XP_006907582.1	0.792	Cytoplasmic dynein 2 heavy chain 1
19	9402.XP_006921211.1	0.787	Tetratricopeptide repeat protein 21B
20	9402.XP_006908403.1	0.782	Intraflagellar transport protein 74 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0008092	1.000	cytoskeletal protein binding
GO:0019894	0.985	kinesin binding
GO:0003774	0.931	cytoskeletal motor activity
GO:0003777	0.923	microtubule motor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0032388	0.985	positive regulation of intracellular transport
GO:0032886	0.981	regulation of microtubule-based process
GO:0032878	0.978	regulation of establishment or maintenance of cell polarity
GO:0033157	0.978	regulation of intracellular protein transport
GO:1903829	0.969	positive regulation of protein localization
GO:0060632	0.957	regulation of microtubule-based movement
GO:0048259	0.955	regulation of receptor-mediated endocytosis
GO:0090316	0.955	positive regulation of intracellular protein transport
GO:0045807	0.946	positive regulation of endocytosis
GO:0008360	0.936	regulation of cell shape
GO:0071840	0.887	cellular component organization or biogenesis
GO:0048260	0.883	positive regulation of receptor-mediated endocytosis
GO:0016043	0.878	cellular component organization
GO:0006996	0.677	organelle organization
GO:0007017	0.487	microtubule-based process
GO:0051179	0.480	localization
GO:0051641	0.429	cellular localization
GO:0022607	0.420	cellular component assembly
GO:0051234	0.408	establishment of localization
GO:0050896	0.407	response to stimulus
GO:0032502	0.344	developmental process
GO:0070925	0.333	organelle assembly
GO:0032501	0.331	multicellular organismal process
GO:0051716	0.320	cellular response to stimulus
GO:0048856	0.318	anatomical structure development
GO:0006810	0.306	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	1.000	cytoplasm
GO:0005856	1.000	cytoskeleton
GO:0032991	0.990	protein-containing complex
GO:0005929	0.990	cilium
GO:0005829	0.927	cytosol
GO:0099568	0.904	cytoplasmic region
GO:0032838	0.860	plasma membrane bounded cell projection cytoplasm
GO:0044297	0.838	cell body
GO:0030424	0.836	axon
GO:0036477	0.831	somatodendritic compartment
GO:0030054	0.824	cell junction
GO:0043025	0.824	neuronal cell body
GO:0015630	0.820	microtubule cytoskeleton
GO:0120111	0.812	neuron projection cytoplasm
GO:0045202	0.801	synapse
GO:0097014	0.797	ciliary plasm
GO:1904115	0.796	axon cytoplasm
GO:0097470	0.787	ribbon synapse
GO:0005930	0.787	axoneme
GO:0005815	0.586	microtubule organizing center
GO:0043231	0.583	intracellular membrane-bounded organelle
GO:0005875	0.516	microtubule associated complex
GO:0005871	0.305	kinesin complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]