StarFunc result for job id Q9Y4A5

User Input

>input (1400 residues)
MAFVATQGATVVDQTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTSSPQYST
FLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEIIHRIPTNEHLRPHTKNVLSVMFRF
LETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVKQIYKELPKVVNRYFENPQVIP
ENTVPPPEMVGMITTIAVKVNPEREDSETRTHSIIPRGSLSLKVLAELPIIVVLMYQLYK
LNIHNVVAEFVPLIMNTIAIQVSAQARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQE
LVTKYSQQMVKGMLQLLSNCPAETAHLRKELLIAAKHILTTELRNQFIPCMDKLFDESIL
IGSGYTARETLRPLAYSTLADLVHHVRQHLPLSDLSLAVQLFAKNIDDESLPSSIQTMSC
KLLLNLVDCIRSKSEQESGNGRDVLMRMLEVFVLKFHTIARYQLSAIFKKCKPQSELGAV
EAALPGVPTAPAAPGPAPSPAPVPAPPPPPPPPPPATPVTPAPVPPFEKQGEKDKEDKQT
FQVTDCRSLVKTLVCGVKTITWGITSCKAPGEAQFIPNKQLQPKETQIYIKLVKYAMQAL
DIYQVQIAGNGQTYIRVANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVE
RISKNYALQIVANSFLANPTTSALFATILVEYLLDRLPEMGSNVELSNLYLKLFKLVFGS
VSLFAAENEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFL
PLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQT
LVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGG
SNRKMLKESQKLHYVVTEVQGPSITVEFSDCKASLQLPMEKAIETALDCLKSANTEPYYR
RQAWEVIKCFLVAMMSLEDNKHALYQLLAHPNFTEKTIPNVIISHRYKAQDTPARKTFEQ
ALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQVGSQPSTAMFHSE
ENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKERACQLPLFSY
IVERLCACCYEQAWYAKLGGVVSIKFLMERLPLTWVLQNQQTFLKALLFVMMDLTGEVSN
GAVAMAKTTLEQLLMRCATPLKDEERAEEIVAAQEKSFHHVTHDLVREVTSPNSTVRKQA
MHSLQVLAQVTGKSVTVIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGNTFCTTLQP
RLFTMDLNVVEHKVFYTELLNLCEAEDSALTKLPCYKSLPSLVPLRIAALNALAACNYLP
QSREKIIAALFKALNSTNSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7ktsA	0.674	0.315	4.820E-84	3042	0.694	0.319	7ktsA.pdb.gz
2	PDB:8escZ	0.739	0.312	1.182E-44	3543	0.294	0.116	8escZ.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
3	PDB:5ojsT	0.668	0.292	1.095E-31	3473	0.274	0.110	5ojsT.pdb.gz
4	PDB:6ig9T	0.668	0.299	4.298E-27	3386	0.286	0.118	6ig9T.pdb.gz
5	PDB:4a0cA	0.173	0.200	2.054E-9	1155	0.106	0.128	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
6	PDB:7sglA	0.280	0.135	3.546E-9	3852	0.119	0.043	7sglA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
7	PDB:7tyrA	0.344	0.157	4.351E-9	3905	0.124	0.044	7tyrA.pdb.gz
8	PDB:7k1nA	0.294	0.140	2.842E-8	3634	0.112	0.043	7k1nA.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.
9	PDB:7su3A	0.345	0.156	2.941E-8	3802	0.116	0.043	7su3A.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
10	PDB:6kwyc	0.128	0.104	3.609E-8	1811	0.131	0.102	6kwyc.pdb.gz	Cryo-EM structures of the human PA200 and PA200-20S complex reveal regulation of proteasome gate opening and two PA200 apertures.
11	AFDB:Q586K4	0.165	0.181	9.126E-8	1219	0.116	0.133	Q586K4.pdb.gz	Q586K4_TRYB2 Exportin-T OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=25N14.145 PE=3 SV=1
12	AFDB:Q42510	0.125	0.121	1.199E-7	1451	0.119	0.114	Q42510.pdb.gz	GNOM_ARATH ARF guanine-nucleotide exchange factor GNOM OS=Arabidopsis thaliana OX=3702 GN=GN PE=1 SV=1
13	AFDB:P42695	0.139	0.134	1.472E-7	1498	0.116	0.108	P42695.pdb.gz	CNDD3_HUMAN Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2
14	AFDB:Q6ZQK0	0.157	0.149	2.912E-7	1506	0.117	0.109	Q6ZQK0.pdb.gz	CNDD3_MOUSE Condensin-2 complex subunit D3 OS=Mus musculus OX=10090 GN=Ncapd3 PE=1 SV=3
15	AFDB:Q95Q95	0.139	0.085	3.013E-7	2697	0.114	0.059	Q95Q95.pdb.gz	TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans OX=6239 GN=let-363 PE=2 SV=3
16	AFDB:Q8RWY6	0.133	0.130	4.537E-7	1439	0.114	0.111	Q8RWY6.pdb.gz	CLASP_ARATH CLIP-associated protein OS=Arabidopsis thaliana OX=3702 GN=CLASP PE=1 SV=1
17	AFDB:P11075	0.152	0.115	4.695E-7	2009	0.121	0.084	P11075.pdb.gz	SEC7_YEAST Protein transport protein SEC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC7 PE=1 SV=2
18	AFDB:Q14146	0.173	0.163	5.201E-7	1524	0.126	0.116	Q14146.pdb.gz	URB2_HUMAN Unhealthy ribosome biogenesis protein 2 homolog OS=Homo sapiens OX=9606 GN=URB2 PE=1 SV=2
19	AFDB:P35194	0.102	0.071	6.833E-7	2493	0.149	0.083	P35194.pdb.gz	UTP20_YEAST U3 small nucleolar RNA-associated protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTP20 PE=1 SV=3
20	AFDB:Q9DE14	0.145	0.092	9.290E-7	2654	0.124	0.065	Q9DE14.pdb.gz	ATR_XENLA Serine/threonine-protein kinase atr OS=Xenopus laevis OX=8355 GN=atr PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4ITC5	0.0	2610	3841	0.924	0.337	TRRAP_DANRE Transformation/transcription domain-associated protein OS=Danio rerio OX=7955 GN=trrap PE=3 SV=1
2	A0A8I5Y6J8	0.0	2869	3859	0.993	0.360	A0A8I5Y6J8_RAT Transformation/transcription domain-associated protein OS=Rattus norvegicus OX=10116 GN=Trrap PE=1 SV=1
3	A0A8I6AL99	0.0	2871	3873	0.993	0.359	A0A8I6AL99_RAT Transformation/transcription domain-associated protein OS=Rattus norvegicus OX=10116 GN=Trrap PE=1 SV=1
4	A0A8I6GLC1	0.0	2872	3874	0.993	0.359	A0A8I6GLC1_RAT Transformation/transcription domain-associated protein OS=Rattus norvegicus OX=10116 GN=Trrap PE=1 SV=1
5	F2Z2U4	0.0	2887	3848	0.999	0.364	F2Z2U4_HUMAN Transformation/transcription domain associated protein OS=Homo sapiens OX=9606 GN=TRRAP PE=1 SV=3
6	H0Y4W2	0.0	2891	3873	1.000	0.361	H0Y4W2_HUMAN Transformation/transcription domain associated protein OS=Homo sapiens OX=9606 GN=TRRAP PE=1 SV=2
7	Q8I8U7	0.0	1443	3790	0.527	0.195	TRA1_DROME Transcription-associated protein 1 OS=Drosophila melanogaster OX=7227 GN=Nipped-A PE=1 SV=4
8	Q9Y4A5	0.0	2891	3859	1.000	0.363	TRRAP_HUMAN Transformation/transcription domain-associated protein OS=Homo sapiens OX=9606 GN=TRRAP PE=1 SV=3
9	A0A1D8PPL1	2.12e-179	595	3821	0.311	0.114	A0A1D8PPL1_CANAL Histone acetyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TRA1 PE=4 SV=1
10	P38811	8.08e-170	567	3744	0.310	0.116	TRA1_YEAST Transcription-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRA1 PE=1 SV=1
11	G5EEV2	8.69e-154	520	4064	0.279	0.096	TRR1_CAEEL Transcription-associated protein 1 OS=Caenorhabditis elegans OX=6239 GN=trr-1 PE=2 SV=1
12	F4JPL2	2.80e-150	509	3834	0.312	0.114	F4JPL2_ARATH Phosphotransferases/inositol or phosphatidylinositol kinase OS=Arabidopsis thaliana OX=3702 GN=TRA1B PE=1 SV=1
13	F4IPJ1	3.26e-143	488	3858	0.309	0.112	F4IPJ1_ARATH Phosphatidylinositol 3-and 4-kinase family protein with FAT domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=TRA1A PE=1 SV=1
14	Q10064	4.50e-91	329	3655	0.193	0.074	YAMB_SCHPO Uncharacterized PI3/PI4-kinase family protein C1F5.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1F5.11c PE=3 SV=1
15	Q9HFE8	5.99e-68	256	3699	0.179	0.068	TRA1_SCHPO Transcription-associated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tra1 PE=3 SV=1
16	Q80YV3	1.31e-57	223	2565	0.076	0.041	TRRAP_MOUSE Transformation/transcription domain-associated protein OS=Mus musculus OX=10090 GN=Trrap PE=1 SV=2
17	Q8BZ98	0.14	39.3	863	0.027	0.044	DYN3_MOUSE Dynamin-3 OS=Mus musculus OX=10090 GN=Dnm3 PE=1 SV=1
18	Q9UQ16	0.89	36.6	869	0.026	0.043	DYN3_HUMAN Dynamin-3 OS=Homo sapiens OX=9606 GN=DNM3 PE=1 SV=4
19	A0A0R4IR86	3.3	34.7	1799	0.025	0.019	A0A0R4IR86_DANRE DNA helicase OS=Danio rerio OX=7955 GN=si:ch211-196l7.5 PE=1 SV=1
20	A0A1D8PI83	4.3	34.3	587	0.016	0.039	A0A1D8PI83_CANAL Stn1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=STN1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06861 BALF1	62	14.7	BALF1 protein
2	PF08146 BP28CT	5.6e+02	11.7	BP28CT (NUC211) domain
3	PF04625 DEC-1_N	2.4	18.7	DEC-1 protein, N-terminal region
4	PF17537 DUF5455	2.5e+02	13.6	Family of unknown function (DUF5455)
5	PF01522 Polysacc_deac_1	1.9e+02	13.5	Polysaccharide deacetylase
6	PF20175 Tra1_central	1.6e-205	695.9	Tra1 HEAT repeat central region
7	PF20206 Tra1_ring	2.2e-131	451.5	Tra1 HEAT repeat ring region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000019457

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000003532	0.992	K(lysine) acetyltransferase 5
2	9601.ENSPPYP00000015742	0.990	K(lysine) acetyltransferase 2B
3	9601.ENSPPYP00000001889	0.989	TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
4	9601.ENSPPYP00000015029	0.989	RuvB-like helicase
5	9601.ENSPPYP00000011437	0.988	RuvB-like helicase
6	9601.ENSPPYP00000018640	0.988	SPT3 homolog, SAGA and STAGA complex component
7	9601.ENSPPYP00000004055	0.987	Transcription initiation factor TFIID subunit 10
8	9601.ENSPPYP00000015293	0.987	Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex. Also known as a coactivator for p53/TP53- dependent transcriptional activation (By similarity). Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4 (By similarity)
9	9601.ENSPPYP00000022945	0.986	Transcription initiation factor TFIID subunit 9B
10	9601.ENSPPYP00000021181	0.984	MYC proto-oncogene, bHLH transcription factor
11	9601.ENSPPYP00000008178	0.983	SAGA complex associated factor 29
12	9601.ENSPPYP00000016284	0.983	Coactivates PAX5-dependent transcription together with either SMARCA4 or GCN5L2
13	9601.ENSPPYP00000001660	0.978	DNA methyltransferase 1 associated protein 1
14	9601.ENSPPYP00000005850	0.978	E1A binding protein p400
15	9601.ENSPPYP00000019499	0.978	TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa
16	9601.ENSPPYP00000012531	0.975	MRG/MORF4L binding protein
17	9601.ENSPPYP00000005420	0.963	YEATS domain containing 4
18	9601.ENSPPYP00000007607	0.963	Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA re [...]
19	9601.ENSPPYP00000015372	0.963	Ataxin 7
20	9601.ENSPPYP00000005852	0.956	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	0.999	chromatin binding
GO:0005515	0.989	protein binding
GO:0003824	0.475	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0060255	0.955	regulation of macromolecule metabolic process
GO:0071704	0.954	organic substance metabolic process
GO:0080090	0.952	regulation of primary metabolic process
GO:0044238	0.950	primary metabolic process
GO:0006807	0.946	nitrogen compound metabolic process
GO:0043170	0.943	macromolecule metabolic process
GO:0016570	0.927	histone modification
GO:0009987	0.926	cellular process
GO:0031323	0.919	regulation of cellular metabolic process
GO:0043543	0.908	protein acylation
GO:0019219	0.901	regulation of nucleobase-containing compound metabolic process
GO:0043967	0.863	histone H4 acetylation
GO:0032502	0.854	developmental process
GO:0032501	0.839	multicellular organismal process
GO:0048518	0.786	positive regulation of biological process
GO:0048856	0.770	anatomical structure development
GO:0010604	0.767	positive regulation of macromolecule metabolic process
GO:0045935	0.764	positive regulation of nucleobase-containing compound metabolic process
GO:2001020	0.745	regulation of response to DNA damage stimulus
GO:0007275	0.731	multicellular organism development
GO:0010468	0.726	regulation of gene expression
GO:2000779	0.714	regulation of double-strand break repair
GO:2001022	0.713	positive regulation of response to DNA damage stimulus
GO:0000018	0.709	regulation of DNA recombination
GO:0045739	0.694	positive regulation of DNA repair
GO:0042490	0.663	mechanoreceptor differentiation
GO:0009888	0.645	tissue development
GO:2000781	0.644	positive regulation of double-strand break repair
GO:0048925	0.636	lateral line system development
GO:0043966	0.634	histone H3 acetylation
GO:0030855	0.620	epithelial cell differentiation
GO:0048884	0.602	neuromast development
GO:0008544	0.588	epidermis development
GO:0009889	0.537	regulation of biosynthetic process
GO:1903506	0.527	regulation of nucleic acid-templated transcription
GO:0009913	0.515	epidermal cell differentiation
GO:0006355	0.515	regulation of DNA-templated transcription
GO:0048886	0.390	neuromast hair cell differentiation
GO:0006357	0.308	regulation of transcription by RNA polymerase II
GO:0044237	0.305	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.929	nuclear lumen
GO:0005654	0.900	nucleoplasm
GO:0012505	0.893	endomembrane system
GO:0005737	0.748	cytoplasm
GO:0005794	0.302	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]