StarFunc result for job id Q9Y4A8

User Input

>input (694 residues)
MKHLKRWWSAGGGLLHLTLLLSLAGLRVDLDLYLLLPPPTLLQDELLFLGGPASSAYALS
PFSASGGWGRAGHLHPKGRELDPAAPPEGQLLREVRALGVPFVPRTSVDAWLVHSVAAGS
ADEAHGLLGAAAASSTGGAGASVDGGSQAVQGGGGDPRAARSGPLDAGEEEKAPAEPTAQ
VPDAGGCASEENGVLREKHEAVDHSSQHEENEERVSAQKENSLQQNDDDENKIAEKPDWE
AEKTTESRNERHLNGTDTSFSLEDLFQLLSSQPENSLEGISLGDIPLPGSISDGMNSSAH
YHVNFSQAISQDVNLHEAILLCPNNTFRRDPTARTSQSQEPFLQLNSHTTNPEQTLPGTN
LTGFLSPVDNHMRNLTSQDLLYDLDINIFDEINLMSLATEDNFDPIDVSQLFDEPDSDSG
LSLDSSHNNTSVIKSNSSHSVCDEGAIGYCTDHESSSHHDLEGAVGGYYPEPSKLCHLDQ
SDSDFHGDLTFQHVFHNHTYHLQPTAPESTSEPFPWPGKSQKIRSRYLEDTDRNLSRDEQ
RAKALHIPFSVDEIVGMPVDSFNSMLSRYYLTDLQVSLIRDIRRRGKNKVAAQNCRKRKL
DIILNLEDDVCNLQAKKETLKREQAQCNKAINIMKQKLHDLYHDIFSRLRDDQGRPVNPN
HYALQCTHDGSILIVPKELVASGHKKETQKGKRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y4A8	1.000	1.000	1.332E-102	694	1.000	1.000	Q9Y4A8.pdb.gz	NF2L3_HUMAN Nuclear factor erythroid 2-related factor 3 OS=Homo sapiens OX=9606 GN=NFE2L3 PE=1 SV=1
2	AFDB:A7YYH1	0.211	0.249	3.268E-16	586	0.197	0.234	A7YYH1.pdb.gz
3	AFDB:A0A024R5T1	0.070	0.071	5.475E-2	682	0.150	0.152	A0A024R5T1.pdb.gz
4	AFDB:Q6DRG7	0.093	0.067	5.475E-2	1049	0.135	0.090	Q6DRG7.pdb.gz	MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio OX=7955 GN=ppp1r12a PE=2 SV=2
5	AFDB:Q86PA6	0.053	0.051	5.475E-2	744	0.140	0.130	Q86PA6.pdb.gz	Q86PA6_DROME LD29371p OS=Drosophila melanogaster OX=7227 GN=da PE=1 SV=1
6	AFDB:Q56R80	0.072	0.074	9.683E-2	667	0.150	0.156	Q56R80.pdb.gz	Q56R80_ICTPU E2A-1 transcription factor OS=Ictalurus punctatus OX=7998 GN=tcf3b PE=2 SV=1
7	AFDB:Q50365	0.087	0.062	1.329E-1	1018	0.141	0.096	Q50365.pdb.gz	HMW1_MYCPN Cytadherence high molecular weight protein 1 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) OX=272634 GN=hmw1 PE=1 SV=1
8	AFDB:F1LWM1	0.053	0.039	1.509E-1	1032	0.140	0.094	F1LWM1.pdb.gz	F1LWM1_RAT protein-serine/threonine phosphatase OS=Rattus norvegicus OX=10116 GN=Ssh1 PE=1 SV=3
9	AFDB:O75410	0.078	0.069	1.607E-1	805	0.147	0.127	O75410.pdb.gz	TACC1_HUMAN Transforming acidic coiled-coil-containing protein 1 OS=Homo sapiens OX=9606 GN=TACC1 PE=1 SV=2
10	AFDB:A0A024RAY1	0.079	0.046	1.824E-1	1270	0.154	0.084	A0A024RAY1.pdb.gz
11	PDB:7ls2Q2	0.042	0.195	1.116	110	0.010	0.064	7ls2Q2.pdb.gz	Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.
12	PDB:2w1tA	0.038	0.124	1.438	175	0.013	0.051	2w1tA.pdb.gz
13	PDB:6wq2A	0.040	0.142	1.438	154	0.030	0.136	6wq2A.pdb.gz	Structures of filamentous viruses infecting hyperthermophilic archaea explain DNA stabilization in extreme environments.
14	PDB:5zx3C	0.029	0.019	1.532	1105	0.013	0.008	5zx3C.pdb.gz	Structural basis for transcription initiation by bacterial ECF sigma factors.
15	PDB:5ndgn4	0.045	0.193	1.974	118	0.010	0.059	5ndgn4.pdb.gz	Aminoglycoside interactions and impacts on the eukaryotic ribosome.
16	PDB:6yxxBS	0.080	0.266	2.543	161	0.020	0.087	6yxxBS.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
17	PDB:5svaU	0.053	0.167	2.886	156	0.029	0.128	5svaU.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
18	PDB:4v8mBm	0.054	0.175	3.075	106	0.020	0.132	4v8mBm.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
19	PDB:6ta5D	0.058	0.112	3.491	345	0.010	0.020	6ta5D.pdb.gz
20	PDB:6pwnA	0.047	0.088	3.719	280	0.037	0.093	6pwnA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9WTM4	0.0	810	660	0.673	0.708	NF2L3_MOUSE Nuclear factor erythroid 2-related factor 3 OS=Mus musculus OX=10090 GN=Nfe2l3 PE=1 SV=1
2	Q9Y4A8	0.0	1431	694	1.000	1.000	NF2L3_HUMAN Nuclear factor erythroid 2-related factor 3 OS=Homo sapiens OX=9606 GN=NFE2L3 PE=1 SV=1
3	Q61985	2.13e-92	305	741	0.392	0.367	NF2L1_MOUSE Endoplasmic reticulum membrane sensor NFE2L1 OS=Mus musculus OX=10090 GN=Nfe2l1 PE=1 SV=2
4	J9JIE5	2.31e-92	305	761	0.398	0.363	J9JIE5_HUMAN NFE2 like bZIP transcription factor 1 OS=Homo sapiens OX=9606 GN=NFE2L1 PE=1 SV=1
5	J3QKY3	3.68e-80	268	573	0.267	0.323	J3QKY3_HUMAN NFE2 like bZIP transcription factor 1 OS=Homo sapiens OX=9606 GN=NFE2L1 PE=1 SV=1
6	B4DYE1	4.76e-80	268	584	0.267	0.317	B4DYE1_HUMAN NFE2 like bZIP transcription factor 1 OS=Homo sapiens OX=9606 GN=NFE2L1 PE=1 SV=1
7	F5H1B7	8.84e-80	268	616	0.267	0.300	F5H1B7_HUMAN NFE2 like bZIP transcription factor 1 OS=Homo sapiens OX=9606 GN=NFE2L1 PE=1 SV=1
8	Q14494	8.33e-78	266	772	0.267	0.240	NF2L1_HUMAN Endoplasmic reticulum membrane sensor NFE2L1 OS=Homo sapiens OX=9606 GN=NFE2L1 PE=1 SV=1
9	Q8JIM1	3.96e-50	186	586	0.154	0.183	Q8JIM1_DANRE Nuclear factor erythroid 2-related factor 2 OS=Danio rerio OX=7955 GN=nrf2 PE=2 SV=1
10	O54968	1.07e-45	174	604	0.121	0.139	NF2L2_RAT Nuclear factor erythroid 2-related factor 2 OS=Rattus norvegicus OX=10116 GN=Nfe2l2 PE=1 SV=2
11	Q16621	1.11e-45	169	373	0.108	0.201	NFE2_HUMAN Transcription factor NF-E2 45 kDa subunit OS=Homo sapiens OX=9606 GN=NFE2 PE=1 SV=1
12	Q60795	1.57e-45	173	597	0.120	0.139	NF2L2_MOUSE Nuclear factor erythroid 2-related factor 2 OS=Mus musculus OX=10090 GN=Nfe2l2 PE=1 SV=2
13	Q07279	3.18e-45	167	373	0.107	0.198	NFE2_MOUSE Transcription factor NF-E2 45 kDa subunit OS=Mus musculus OX=10090 GN=Nfe2 PE=1 SV=1
14	Q7ZZR2	1.25e-44	167	419	0.112	0.186	Q7ZZR2_DANRE NFE2 OS=Danio rerio OX=7955 GN=nfe2 PE=2 SV=1
15	Q16236	2.37e-44	170	605	0.150	0.172	NF2L2_HUMAN Nuclear factor erythroid 2-related factor 2 OS=Homo sapiens OX=9606 GN=NFE2L2 PE=1 SV=3
16	K7EIW5	3.53e-44	170	604	0.117	0.134	K7EIW5_HUMAN NFE2 like bZIP transcription factor 2 OS=Homo sapiens OX=9606 GN=NFE2L2 PE=1 SV=2
17	P20482	1.41e-36	150	1383	0.102	0.051	CNC_DROME Segmentation protein cap'n'collar OS=Drosophila melanogaster OX=7227 GN=cnc PE=2 SV=3
18	F6TNN0	1.20e-35	146	922	0.117	0.088	F6TNN0_CIOIN BZIP domain-containing protein OS=Ciona intestinalis OX=7719 GN=nf-e2 PE=1 SV=2
19	G8DKA8	2.57e-33	136	507	0.092	0.126	G8DKA8_DANRE Nrf2b OS=Danio rerio OX=7955 GN=Nrf2b PE=2 SV=1
20	A7SQR2	3.10e-19	87.0	146	0.072	0.342	A7SQR2_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g127893 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	2.9e-05	35.4	bZIP transcription factor
2	PF07716 bZIP_2	0.73	21.3	Basic region leucine zipper
3	PF03131 bZIP_Maf	9.7e-13	59.8	bZIP Maf transcription factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000056233

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000350369	0.930	Transcription factor MafG
2	9606.ENSP00000344903	0.926	Transcription factor MafK
3	9606.ENSP00000345393	0.870	Transcription factor MafF
4	9606.ENSP00000327048	0.752	Transcription factor Maf
5	9606.ENSP00000346694	0.691	Heterogeneous nuclear ribonucleoproteins A2/B1
6	9606.ENSP00000376293	0.686	Oxysterol-binding protein-related protein 6
7	9606.ENSP00000315410	0.676	Oxysterol-binding protein-related protein 3
8	9606.ENSP00000376309	0.656	Heterogeneous nuclear ribonucleoprotein A3
9	9606.ENSP00000309555	0.622	Host cell factor 1
10	9606.ENSP00000286063	0.619	Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A
11	9606.ENSP00000171111	0.617	Kelch-like ECH-associated protein 1
12	9606.ENSP00000442308	0.608	NF-kappa-B-repressing factor
13	9606.ENSP00000386647	0.593	Pejvakin
14	9606.ENSP00000249373	0.588	Smoothened homolog
15	9606.ENSP00000350032	0.570	FERM domain-containing protein 4A
16	9606.ENSP00000420659	0.566	Kelch-like protein 29
17	9606.ENSP00000481091	0.563	Transcriptional adapter 2-alpha
18	9606.ENSP00000417748	0.559	DNA damage inducible 1 homolog 2
19	9606.ENSP00000439120	0.551	Transcription factor NF-E2 45 kDa subunit
20	9606.ENSP00000308022	0.550	Transcriptional adapter 2-beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0043565	0.991	sequence-specific DNA binding
GO:0003690	0.923	double-stranded DNA binding
GO:1990837	0.893	sequence-specific double-stranded DNA binding
GO:0000976	0.528	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0009987	0.993	cellular process
GO:0006807	0.984	nitrogen compound metabolic process
GO:0044237	0.984	cellular metabolic process
GO:0043170	0.975	macromolecule metabolic process
GO:1901360	0.965	organic cyclic compound metabolic process
GO:0009058	0.908	biosynthetic process
GO:0034641	0.907	cellular nitrogen compound metabolic process
GO:0044249	0.899	cellular biosynthetic process
GO:1901576	0.898	organic substance biosynthetic process
GO:0046483	0.873	heterocycle metabolic process
GO:0006725	0.869	cellular aromatic compound metabolic process
GO:0065007	0.861	biological regulation
GO:0006139	0.856	nucleobase-containing compound metabolic process
GO:0050789	0.843	regulation of biological process
GO:0050794	0.779	regulation of cellular process
GO:0018130	0.768	heterocycle biosynthetic process
GO:0019438	0.765	aromatic compound biosynthetic process
GO:0044271	0.764	cellular nitrogen compound biosynthetic process
GO:1901362	0.759	organic cyclic compound biosynthetic process
GO:0090304	0.758	nucleic acid metabolic process
GO:0016070	0.754	RNA metabolic process
GO:0019222	0.661	regulation of metabolic process
GO:0060255	0.649	regulation of macromolecule metabolic process
GO:0034654	0.649	nucleobase-containing compound biosynthetic process
GO:0010467	0.606	gene expression
GO:0010468	0.588	regulation of gene expression
GO:0032774	0.584	RNA biosynthetic process
GO:0080090	0.578	regulation of primary metabolic process
GO:0051171	0.578	regulation of nitrogen compound metabolic process
GO:0010556	0.557	regulation of macromolecule biosynthetic process
GO:0031326	0.557	regulation of cellular biosynthetic process
GO:0006355	0.547	regulation of DNA-templated transcription
GO:0006351	0.516	DNA-templated transcription
GO:0048519	0.362	negative regulation of biological process
GO:0048522	0.305	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.997	protein-containing complex
GO:0140513	0.977	nuclear protein-containing complex
GO:0005737	0.973	cytoplasm
GO:0005667	0.963	transcription regulator complex
GO:0031981	0.955	nuclear lumen
GO:0005654	0.948	nucleoplasm
GO:0090575	0.886	RNA polymerase II transcription regulator complex
GO:0005829	0.874	cytosol
GO:0012505	0.433	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]