StarFunc result for job id Q9Y4B4

User Input

>input (1467 residues)
MSDESASGSDPDLDPDVELEDAEEEEEEEEVAVEECDRDDEEDLLDDPSLEGMCGTEHAQ
LGEDGQQPPRCTSTTSSQSEPSEQLRRHQGKNLASEDPKKKRAQKPSHMRRNIRKLLRED
QLEPVTKAAQQEELERRKRLEQQRKDYAAPIPTVPLEFLPEEIALRASDGPQLPPRVLAQ
EVICLDSSSGSEDEKSSRDEVIELSSGEEDTLHIVDSSESVSEDDEEEEKGGTHVNDVLN
QRDALGRVLVNLNHPPEEENVFLAPQLARAVKPHQIGGIRFLYDNLVESLERFKTSSGFG
CILAHSMGLGKTLQVISFIDVLFRHTPAKTVLAIVPVNTLQNWLAEFNMWLPPPEALPAD
NKPEEVQPRFFKVHILNDEHKTMASRAKVMADWVSEGGVLLMGYEMYRLLTLKKSFATGR
PKKTKKRSHPVIIDLDEEDRQQEFRREFEKALCRPGPDVVICDEGHRIKNCQASTSQALK
NIRSRRRVVLTGYPLQNNLIEYWCMVDFVRPDFLGTRQEFSNMFERPILNGQCIDSTPQD
VRLMRYRSHVLHSLLEGFVQRRGHTVLKIHLPAKEENVILVRLSKIQRDLYTQFMDRFRD
CGSSGWLGLNPLKAFCVCCKIWNHPDVLYEALQKESLANEQDLDVEELGSAGTSARCPPQ
GTKGKGEDSTLASSMGEATNSKFLQGVGFNPFQERGNNIVTYEWAKDLLTNYQTGVLENS
PKMVLLFHLIEESVKLGDKILVFSQSLSTLALIEEFLGKREVPCPPGTEGQGAQKWVRNI
SYFRLDGSTPAFERERLINQFNDPSNLTTWLFLLSTRAGCLGVNLIGANRVVVFDASWNP
CHDAQAVCRVYRYGQKKPCYIYRLVADYTLEKKIYDRQISKQGMSDRVVDDLNPMLNFTR
KEVENLLHFVEKEPAPQVSLNVKGIKESVLQLACLKYPHLITKEPFEHESLLLNRKDHKL
TKAEKKAAKKSYEEDKRTSVPYTRPSYAQYYPASDQSLTSIPAFSQRNWQPTLKGDEKPV
ASVRPVQSTPIPMMPRHVPLGGSVSSASSTNPSMNFPINYLQRAGVLVQKVVTTTDIVIP
GLNSSTDVQARINAGESIHIIRGTKGTYIRTSDGRIFAVRATGKPKVPEDGRMAASGSQG
PSCESTSNGRHSASSPKAPDPEGLARPVSPDSPEIISELQQYADVAAARESRQSSPSTNA
ALPGPPAQLMDSSAVPGTALGTEPRLGGHCLNSSLLVTGQPCGDRHPVLDLRGHKRKLAT
PPAAQESSRRRSRKGHLPAPVQPYEHGYPVSGGFAMPPVSLNHNLTTPFTSQAGENSLFM
GSTPSYYQLSNLLADARLVFPVTTDPLVPAGPVSSSSTATSVTASNPSFMLNPSVPGILP
SYSLPFSQPLLSEPRMFAPFPSPVLPSNLSRGMSIYPGYMSPHAGYPAGGLLRSQVPPFD
SHEVAEVGFSSNDDEDKDDDVIEVTGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y4B4	0.999	0.999	0.000	1467	1.000	1.000	Q9Y4B4.pdb.gz	ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens OX=9606 GN=RAD54L2 PE=1 SV=4
2	AFDB:Q61687	0.413	0.249	5.175E-60	2476	0.244	0.145	Q61687.pdb.gz	ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus OX=10090 GN=Atrx PE=1 SV=3
3	AFDB:P46100	0.408	0.245	6.272E-59	2492	0.237	0.139	P46100.pdb.gz	ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX PE=1 SV=6
4	PDB:7oo3b	0.321	0.844	9.241E-37	534	0.121	0.331	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
5	AFDB:O14647	0.286	0.233	2.494E-30	1828	0.193	0.155	O14647.pdb.gz	CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens OX=9606 GN=CHD2 PE=1 SV=2
6	PDB:6jylK	0.262	0.720	4.553E-25	504	0.104	0.302	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
7	PDB:6tdaS	0.267	0.483	3.067E-23	783	0.106	0.199	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
8	PDB:5vvrM	0.263	0.709	6.688E-23	503	0.110	0.322	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
9	PDB:6g0lM	0.245	0.410	9.622E-23	855	0.097	0.167	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
10	PDB:6gejM	0.261	0.531	2.452E-22	688	0.107	0.228	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
11	PDB:7epuB	0.197	0.344	3.854E-21	748	0.096	0.189	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
12	PDB:6g0lW	0.254	0.412	4.060E-21	878	0.098	0.164	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
13	PDB:6uxwA	0.273	0.495	6.827E-21	778	0.112	0.212	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
14	AFDB:Q8T145	0.244	0.204	1.014E-19	1789	0.139	0.114	Q8T145.pdb.gz	Q8T145_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274841 PE=3 SV=2
15	PDB:6kw3Y	0.254	0.634	2.221E-19	548	0.106	0.285	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
16	AFDB:Q8IYD8	0.238	0.177	9.040E-16	2048	0.124	0.089	Q8IYD8.pdb.gz	FANCM_HUMAN Fanconi anemia group M protein OS=Homo sapiens OX=9606 GN=FANCM PE=1 SV=2
17	AFDB:Q9VDA0	0.221	0.217	6.445E-11	1489	0.124	0.122	Q9VDA0.pdb.gz	FANCM_DROME DEAD-box ATP-dependent DNA helicase Fancm OS=Drosophila melanogaster OX=7227 GN=Fancm PE=1 SV=2
18	AFDB:D3Z4R1	0.170	0.173	7.040E-10	1434	0.128	0.131	D3Z4R1.pdb.gz	HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus OX=10090 GN=Hfm1 PE=3 SV=2
19	AFDB:Q9UHI6	0.202	0.338	2.677E-8	824	0.072	0.127	Q9UHI6.pdb.gz	DDX20_HUMAN Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20 PE=1 SV=2
20	AFDB:F4IDQ6	0.149	0.140	2.790E-4	1576	0.114	0.106	F4IDQ6.pdb.gz	NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana OX=3702 GN=NIH PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99NG0	0.0	2766	1466	0.959	0.960	ARIP4_MOUSE Helicase ARIP4 OS=Mus musculus OX=10090 GN=Rad54l2 PE=1 SV=1
2	Q9Y4B4	0.0	3033	1467	1.000	1.000	ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens OX=9606 GN=RAD54L2 PE=1 SV=4
3	F4HW51	4.12e-137	461	1479	0.190	0.189	CHR20_ARATH Protein CHROMATIN REMODELING 20 OS=Arabidopsis thaliana OX=3702 GN=ATRX PE=2 SV=2
4	Q9GQN5	7.57e-137	457	1311	0.192	0.215	ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster OX=7227 GN=XNP PE=1 SV=2
5	Q18241	5.86e-116	398	1274	0.136	0.157	Q18241_CAEEL Helicase ARIP4 OS=Caenorhabditis elegans OX=6239 GN=rad-26 PE=1 SV=2
6	Q61687	1.27e-79	294	2476	0.108	0.064	ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus OX=10090 GN=Atrx PE=1 SV=3
7	F1MQ85	1.43e-79	293	2478	0.104	0.061	F1MQ85_BOVIN DNA helicase OS=Bos taurus OX=9913 GN=ATRX PE=4 SV=3
8	A4LAA3	1.57e-79	293	2492	0.103	0.061	A4LAA3_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=ATRX PE=4 SV=1
9	P46100	1.57e-79	293	2492	0.103	0.061	ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX PE=1 SV=6
10	P41410	1.59e-77	278	852	0.136	0.235	RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp54 PE=1 SV=2
11	Q5AKX3	1.25e-70	257	848	0.142	0.246	Q5AKX3_CANAL DNA-dependent ATPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD54 PE=3 SV=1
12	F1Q8K0	1.60e-70	254	738	0.134	0.266	RAD54_DANRE DNA repair and recombination protein RAD54-like OS=Danio rerio OX=7955 GN=rad54l PE=1 SV=1
13	Q92698	1.03e-68	249	747	0.127	0.249	RAD54_HUMAN DNA repair and recombination protein RAD54-like OS=Homo sapiens OX=9606 GN=RAD54L PE=1 SV=2
14	Q385M5	1.06e-68	254	1037	0.130	0.184	Q385M5_TRYB2 DNA repair and recombination protein RAD54, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3110 PE=4 SV=1
15	F1LYB7	2.39e-68	251	888	0.132	0.217	F1LYB7_RAT RAD54 homolog B OS=Rattus norvegicus OX=10116 GN=Rad54b PE=4 SV=2
16	A0A8I6AM82	2.84e-68	251	911	0.132	0.212	A0A8I6AM82_RAT RAD54 homolog B OS=Rattus norvegicus OX=10116 GN=Rad54b PE=4 SV=1
17	Q6PFE3	6.48e-68	249	886	0.132	0.218	RA54B_MOUSE DNA repair and recombination protein RAD54B OS=Mus musculus OX=10090 GN=Rad54b PE=2 SV=1
18	P70270	3.49e-67	244	747	0.127	0.250	RAD54_MOUSE DNA repair and recombination protein RAD54-like OS=Mus musculus OX=10090 GN=Rad54l PE=1 SV=2
19	Q9Y620	7.68e-66	244	910	0.125	0.201	RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens OX=9606 GN=RAD54B PE=1 SV=1
20	Q0PCS3	3.15e-65	242	910	0.123	0.199	CHR25_ARATH Protein CHROMATIN REMODELING 25 OS=Arabidopsis thaliana OX=3702 GN=CHR25 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16203 ERCC3_RAD25_C	1.7e+02	12.9	ERCC3/RAD25/XPB C-terminal helicase
2	PF00271 Helicase_C	9.9e-11	53.4	Helicase conserved C-terminal domain
3	PF04851 ResIII	0.0001	33.8	Type III restriction enzyme, res subunit
4	PF00176 SNF2-rel_dom	7.7e-48	174.6	SNF2-related domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386520

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363822	0.928	Androgen receptor
2	9606.ENSP00000299601	0.805	RNA polymerase-associated protein LEO1
3	9606.ENSP00000379182	0.791	mRNA export factor
4	9606.ENSP00000381932	0.784	Dual specificity tyrosine-phosphorylation-regulated kinase 1A
5	9606.ENSP00000307208	0.738	Nucleosome-remodeling factor subunit BPTF
6	9606.ENSP00000288221	0.698	ERC protein 2
7	9606.ENSP00000374455	0.695	Sequestosome-1
8	9606.ENSP00000419101	0.672	Voltage-dependent calcium channel subunit alpha-2/delta-3
9	9606.ENSP00000483236	0.564	DDB1- and CUL4-associated factor 7
10	9606.ENSP00000405965	0.543	Small ubiquitin-related modifier 2
11	9606.ENSP00000371475	0.530	TP53-binding protein 1
12	9606.ENSP00000376077	0.526	Small ubiquitin-related modifier 1
13	9606.ENSP00000362690	0.524	Steroidogenic factor 1
14	9606.ENSP00000249636	0.520	E3 SUMO-protein ligase PIAS1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.896	catalytic activity
GO:0097159	0.876	organic cyclic compound binding
GO:1901363	0.872	heterocyclic compound binding
GO:0003676	0.823	nucleic acid binding
GO:0003677	0.726	DNA binding
GO:0140657	0.523	ATP-dependent activity
GO:0140640	0.304	catalytic activity, acting on a nucleic acid

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0080090	0.986	regulation of primary metabolic process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0031323	0.984	regulation of cellular metabolic process
GO:0010468	0.984	regulation of gene expression
GO:0009889	0.976	regulation of biosynthetic process
GO:0051171	0.962	regulation of nitrogen compound metabolic process
GO:0045944	0.945	positive regulation of transcription by RNA polymerase II
GO:0009987	0.855	cellular process
GO:0043170	0.728	macromolecule metabolic process
GO:0044238	0.704	primary metabolic process
GO:0006807	0.703	nitrogen compound metabolic process
GO:0044237	0.600	cellular metabolic process
GO:0034641	0.509	cellular nitrogen compound metabolic process
GO:1901360	0.496	organic cyclic compound metabolic process
GO:0006725	0.496	cellular aromatic compound metabolic process
GO:0046483	0.487	heterocycle metabolic process
GO:0090304	0.458	nucleic acid metabolic process
GO:0050896	0.450	response to stimulus
GO:0051716	0.309	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016604	0.982	nuclear body
GO:0043232	0.959	intracellular non-membrane-bounded organelle
GO:0032991	0.862	protein-containing complex
GO:0016607	0.682	nuclear speck
GO:0005737	0.474	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]