StarFunc result for job id Q9Y4B5

User Input

>input (1905 residues)
METLNGPAGGGAPDAKLQPPGQHHRHHHLHPVAERRRLHRAPSPARPFLKDLHARPAAPG
PAVPSSGRAPAPAAPRSPNLAGKAPPSPGSLAAPGRLSRRSGGVPGAKDKPPPGAGARAA
GGAKAALGSRRAARVAPAEPLSRAGKPPGAEPPSAAAKGRKAKRGSRAPPARTVGPPTPA
ARIPAVTLAVTSVAGSPARCSRISHTDSSSDLSDCPSEPLSDEQRLLPAASSDAESGTGS
SDREPPRGAPTPSPAARGAPPGSPEPPALLAAPLAAGACPGGRSIPSGVSGGFAGPGVAE
DVRGRSPPERPVPGTPKEPSLGEQSRLVPAAEEEELLREMEELRSENDYLKDELDELRAE
MEEMRDSYLEEDVYQLQELRRELDRANKNCRILQYRLRKAEQKSLKVAETGQVDGELIRS
LEQDLKVAKDVSVRLHHELKTVEEKRAKAEDENETLRQQMIEVEISKQALQNELERLKES
SLKRRSTREMYKEKKTFNQDDSADLRCQLQFAKEEAFLMRKKMAKLGREKDELEQELQKY
KSLYGDVDSPLPTGEAGGPPSTREAELKLRLKLVEEEANILGRKIVELEVENRGLKAEME
DMRGQQEREGPGRDHAPSIPTSPFGDSLESSTELRRHLQFVEEEAELLRRSISEIEDHNR
QLTHELSKFKFEPPREPGWLGEGASPGAGGGAPLQEELKSARLQISELSGKVLKLQHENH
ALLSNIQRCDLAAHLGLRAPSPRDSDAESDAGKKESDGEESRLPQPKREGPVGGESDSEE
MFEKTSGFGSGKPSEASEPCPTELLKAREDSEYLVTLKHEAQRLERTVERLITDTDSFLH
DAGLRGGAPLPGPGLQGEEEQGEGDQQEPQLLGTINAKMKAFKKELQAFLEQVNRIGDGL
SPLPHLTESSSFLSTVTSVSRDSPIGNLGKELGPDLQSRLKEQLEWQLGPARGDERESLR
LRAARELHRRADGDTGSHGLGGQTCFSLEMEEEHLYALRWKELEMHSLALQNTLHERTWS
DEKNLMQQELRSLKQNIFLFYVKLRWLLKHWRQGKQMEEEGEEFTEGEHPETLSRLGELG
VQGGHQADGPDHDSDRGCGFPVGEHSPHSRVQIGDHSLRLQTADRGQPHKQVVENQQLFS
AFKALLEDFRAELREDERARLRLQQQYASDKAAWDVEWAVLKCRLEQLEEKTENKLGELG
SSAESKGALKKEREVHQKLLADSHSLVMDLRWQIHHSEKNWNREKVELLDRLDRDRQEWE
RQKKEFLWRIEQLQKENSPRRGGSFLCDQKDGNVRPFPHQGSLRMPRPVAMWPCADADSI
PFEDRPLSKLKESDRCSASENLYLDALSLDDEPEEPPAHRPEREFRNRLPEEEENHKGNL
QRAVSVSSMSEFQRLMDISPFLPEKGLPSTSSKEDVTPPLSPDDLKYIEEFNKSWDYTPN
RGHNGGGPDLWADRTEVGRAGHEDSTEPFPDSSWYLTTSVTMTTDTMTSPEHCQKQPLRS
HVLTEQSGLRVLHSPPAVRRVDSITAAGGEGPFPTSRARGSPGDTKGGPPEPMLSRWPCT
SPRHSRDYVEGARRPLDSPLCTSLGFASPLHSLEMSKNLSDDMKEVAFSVRNAICSGPGE
LQVKDMACQTNGSRTMGTQTVQTISVGLQTEALRGSGVTSSPHKCLTPKAGGGATPVSSP
SRSLRSRQVAPAIEKVQAKFERTCCSPKYGSPKLQRKPLPKADQPNNRTSPGMAQKGYSE
SAWARSTTTRESPVHTTINDGLSSLFNIIDHSPVVQDPFQKGLRAGSRSRSAEPRPELGP
GQETGTNSRGRSPSPIGVGSEMCREEGGEGTPVKQDLSAPPGYTLTENVARILNKKLLEH
ALKEERRQAAHGPPGLHSDSHSLGDTAEPGPMENQTVLLTAPWGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UHU5	0.359	0.353	0.000	1945	0.820	0.804	Q3UHU5.pdb.gz	MTCL1_MOUSE Microtubule cross-linking factor 1 OS=Mus musculus OX=10090 GN=Mtcl1 PE=1 SV=1
2	AFDB:Q9Y4B5	1.000	1.000	0.000	1905	1.000	1.000	Q9Y4B5.pdb.gz	MTCL1_HUMAN Microtubule cross-linking factor 1 OS=Homo sapiens OX=9606 GN=MTCL1 PE=1 SV=5
3	AFDB:P86839	0.045	0.061	2.986E-10	1265	0.094	0.142	P86839.pdb.gz	NEST_DANRE Nestin OS=Danio rerio OX=7955 GN=nes PE=2 SV=1
4	AFDB:Q9P219	0.043	0.041	5.842E-10	2028	0.131	0.123	Q9P219.pdb.gz	DAPLE_HUMAN Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3
5	AFDB:A1Z8P9	0.044	0.037	9.992E-10	2346	0.148	0.120	A1Z8P9.pdb.gz	TPR_DROME Nucleoprotein TPR OS=Drosophila melanogaster OX=7227 GN=Mtor PE=1 SV=1
6	AFDB:Q5SNZ0	0.039	0.040	1.222E-9	1873	0.120	0.122	Q5SNZ0.pdb.gz	GRDN_MOUSE Girdin OS=Mus musculus OX=10090 GN=Ccdc88a PE=1 SV=2
7	AFDB:Q80U93	0.037	0.034	2.235E-9	2085	0.131	0.119	Q80U93.pdb.gz	NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus OX=10090 GN=Nup214 PE=1 SV=2
8	AFDB:P85120	0.038	0.036	1.046E-8	2058	0.122	0.113	P85120.pdb.gz	DAPLE_XENLA Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c PE=1 SV=1
9	AFDB:Q6P5H2	0.047	0.048	2.862E-8	1864	0.149	0.152	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
10	AFDB:E7FE29	0.048	0.038	7.323E-8	2557	0.113	0.084	E7FE29.pdb.gz
11	PDB:7z37DP1	0.041	0.261	2.294	273	0.010	0.073	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.
12	PDB:1serB	0.035	0.141	2.806	421	0.008	0.036	1serB.pdb.gz	The 2.9 A crystal structure of T. thermophilus seryl-tRNA synthetase complexed with tRNA(Ser).
13	PDB:7ungD3	0.044	0.232	3.431	317	0.010	0.063	7ungD3.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
14	PDB:7rroA0	0.040	0.230	3.924	221	0.008	0.072	7rroA0.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
15	PDB:2q0oD	0.035	0.705	4.196	87	0.007	0.149	2q0oD.pdb.gz	Structural basis for antiactivation in bacterial quorum sensing.
16	PDB:6r1mB	0.031	0.114	4.196	428	0.007	0.033	6r1mB.pdb.gz	Structure-Guided Enhancement of Selectivity of Chemical Probe Inhibitors Targeting Bacterial Seryl-tRNA Synthetase.
17	PDB:6s1kE	0.032	0.333	4.488	102	0.003	0.049	6s1kE.pdb.gz
18	PDB:7ungC4	0.046	0.356	4.488	219	0.007	0.059	7ungC4.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
19	PDB:1u2mC	0.035	0.404	5.132	143	0.004	0.056	1u2mC.pdb.gz
20	PDB:4ohfB	0.033	0.113	5.488	458	0.006	0.024	4ohfB.pdb.gz	Allosteric regulation and substrate activation in cytosolic nucleotidase II from Legionella pneumophila.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E1U8D0	0.0	684	1418	0.290	0.390	SOGA1_MOUSE Protein SOGA1 OS=Mus musculus OX=10090 GN=Soga1 PE=1 SV=3
2	Q3UHU5	0.0	2865	1945	0.818	0.801	MTCL1_MOUSE Microtubule cross-linking factor 1 OS=Mus musculus OX=10090 GN=Mtcl1 PE=1 SV=1
3	Q9Y4B5	0.0	3846	1905	1.000	1.000	MTCL1_HUMAN Microtubule cross-linking factor 1 OS=Homo sapiens OX=9606 GN=MTCL1 PE=1 SV=5
4	O94964	6.61e-165	545	1423	0.202	0.270	SOGA1_HUMAN Protein SOGA1 OS=Homo sapiens OX=9606 GN=SOGA1 PE=1 SV=2
5	P85120	4.57e-06	54.7	2058	0.057	0.053	DAPLE_XENLA Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c PE=1 SV=1
6	Q6ZU52	3.49e-05	51.2	694	0.013	0.035	K0408_HUMAN Uncharacterized protein KIAA0408 OS=Homo sapiens OX=9606 GN=KIAA0408 PE=1 SV=1
7	Q9I8F3	0.006	43.9	539	0.035	0.122	Q9I8F3_CHICK Muscle-derived protein 62 OS=Gallus gallus OX=9031 GN=MDP62 PE=2 SV=1
8	O74689	0.018	42.4	586	0.019	0.061	NDE1_EMENI Nuclear distribution protein nudE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nudE PE=1 SV=1
9	Q382P4	0.018	42.7	1299	0.056	0.082	Q382P4_TRYB2 IF rod domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.52.0008 PE=4 SV=1
10	P09491	0.021	41.6	284	0.029	0.197	TPM2_DROME Tropomyosin-2 OS=Drosophila melanogaster OX=7227 GN=Tm2 PE=2 SV=1
11	Q24564	0.029	41.6	635	0.021	0.063	MERH_DROME Moesin/ezrin/radixin homolog 2 OS=Drosophila melanogaster OX=7227 GN=Mer PE=1 SV=1
12	Q5T1M5	0.075	40.4	1219	0.027	0.043	FKB15_HUMAN FK506-binding protein 15 OS=Homo sapiens OX=9606 GN=FKBP15 PE=1 SV=2
13	Q16204	0.11	39.7	474	0.031	0.127	CCDC6_HUMAN Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2
14	Q3V6T2	0.11	40.0	1871	0.040	0.041	GRDN_HUMAN Girdin OS=Homo sapiens OX=9606 GN=CCDC88A PE=1 SV=2
15	D3ZYD7	0.13	39.7	1523	0.055	0.068	D3ZYD7_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=1 SV=4
16	E9PV66	0.14	39.7	2605	0.026	0.019	E9PV66_MOUSE Myosin XVIIIb OS=Mus musculus OX=10090 GN=Myo18b PE=1 SV=1
17	A0A8I6A5W7	0.15	39.7	1873	0.055	0.056	A0A8I6A5W7_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=4 SV=1
18	A0A8I5ZW24	0.17	39.7	1845	0.048	0.050	A0A8I5ZW24_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=4 SV=1
19	Q6AW69	0.18	39.3	1297	0.030	0.045	CGNL1_MOUSE Cingulin-like protein 1 OS=Mus musculus OX=10090 GN=Cgnl1 PE=1 SV=3
20	Q6VGS5	0.19	39.3	2009	0.053	0.050	DAPLE_MOUSE Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14818 DUF4482	1.2e-41	154.3	Domain of unknown function (DUF4482)
2	PF11365 SOGA	1.4e-62	220.1	Protein SOGA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000022492

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000016685	0.811	Non-specific serine/threonine protein kinase
2	9593.ENSGGOP00000001427	0.644	Eukaryotic elongation factor, selenocysteine-tRNA-specific
3	9593.ENSGGOP00000000947	0.626	Non-specific serine/threonine protein kinase
4	9593.ENSGGOP00000013315	0.585	Klotho beta
5	9593.ENSGGOP00000004411	0.570	Coiled-coil domain containing 170
6	9593.ENSGGOP00000013229	0.567	Uncharacterized protein
7	9593.ENSGGOP00000002753	0.548	Echinoderm microtubule associated protein like 6
8	9593.ENSGGOP00000018248	0.542	Family with sequence similarity 13, member A
9	9593.ENSGGOP00000023507	0.533	Uncharacterized protein
10	9593.ENSGGOP00000013270	0.529	Fc receptor-like 3
11	9593.ENSGGOP00000010396	0.524	Anthrax toxin receptor-like
12	9593.ENSGGOP00000007279	0.523	A kinase (PRKA) anchor protein 9
13	9593.ENSGGOP00000019222	0.523	ATPase, Cu++ transporting, beta polypeptide

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	1.000	microtubule binding
GO:0003723	0.998	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0009987	0.990	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0007017	0.963	microtubule-based process
GO:0006996	0.916	organelle organization
GO:0048518	0.884	positive regulation of biological process
GO:0048522	0.866	positive regulation of cellular process
GO:0060341	0.855	regulation of cellular localization
GO:0051049	0.852	regulation of transport
GO:0032880	0.829	regulation of protein localization
GO:0007010	0.724	cytoskeleton organization
GO:0000226	0.649	microtubule cytoskeleton organization
GO:0019222	0.475	regulation of metabolic process
GO:0007163	0.436	establishment or maintenance of cell polarity
GO:0031323	0.393	regulation of cellular metabolic process
GO:0060255	0.325	regulation of macromolecule metabolic process
GO:0051050	0.318	positive regulation of transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030496	0.999	midbody
GO:0005819	0.995	spindle
GO:0000922	0.994	spindle pole
GO:0016020	0.919	membrane
GO:0071944	0.911	cell periphery
GO:0005886	0.884	plasma membrane
GO:0005737	0.755	cytoplasm
GO:0043227	0.740	membrane-bounded organelle
GO:0043231	0.606	intracellular membrane-bounded organelle
GO:0031981	0.567	nuclear lumen
GO:0005654	0.523	nucleoplasm
GO:0005829	0.486	cytosol
GO:0005813	0.327	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]