StarFunc result for job id Q9Y4B6

User Input

>input (1507 residues)
MTTVVVHVDSKAELTTLLEQWEKEHGSGQDMVPILTRMSQLIEKETEEYRKGDPDPFDDR
HPGRADPECMLGHLLRILFKNDDFMNALVNAYVMTSREPPLNTAACRLLLDIMPGLETAV
VFQEKEGIVENLFKWAREADQPLRTYSTGLLGGAMENQDIAANYRDENSQLVAIVLRRLR
ELQLQEVALRQENKRPSPRKLSSEPLLPLDEEAVDMDYGDMAVDVVDGDQEEASGDMEIS
FHLDSGHKTSSRVNSTTKPEDGGLKKNKSAKQGDRENFRKAKQKLGFSSSDPDRMFVELS
NSSWSEMSPWVIGTNYTLYPMTPAIEQRLILQYLTPLGEYQELLPIFMQLGSRELMMFYI
DLKQTNDVLLTFEALKHLASLLLHNKFATEFVAHGGVQKLLEIPRPSMAATGVSMCLYYL
SYNQDAMERVCMHPHNVLSDVVNYTLWLMECSHASGCCHATMFFSICFSFRAVLELFDRY
DGLRRLVNLISTLEILNLEDQGALLSDDEIFASRQTGKHTCMALRKYFEAHLAIKLEQVK
QSLQRTEGGILVHPQPPYKACSYTHEQIVEMMEFLIEYGPAQLYWEPAEVFLKLSCVQLL
LQLISIACNWKTYYARNDTVRFALDVLAILTVVPKIQLQLAESVDVLDEAGSTVSTVGIS
IILGVAEGEFFIHDAEIQKSALQIIINCVCGPDNRISSIGKFISGTPRRKLPQNPKSSEH
TLAKMWNVVQSNNGIKVLLSLLSIKMPITDADQIRALACKALVGLSRSSTVRQIISKLPL
FSSCQIQQLMKEPVLQDKRSDHVKFCKYAAELIERVSGKPLLIGTDVSLARLQKADVVAQ
SRISFPEKELLLLIRNHLISKGLGETATVLTKEADLPMTAASHSSAFTPVTAAASPVSLP
RTPRIANGIATRLGSHAAVGASAPSAPTAHPQPRPPQGPLALPGPSYAGNSPLIGRISFI
RERPSPCNGRKIRVLRQKSDHGAYSQSPAIKKQLDRHLPSPPTLDSIITEYLREQHARCK
NPVATCPPFSLFTPHQCPEPKQRRQAPINFTSRLNRRASFPKYGGVDGGCFDRHLIFSRF
RPISVFREANEDESGFTCCAFSARERFLMLGTCTGQLKLYNVFSGQEEASYNCHNSAITH
LEPSRDGSLLLTSATWSQPLSALWGMKSVFDMKHSFTEDHYVEFSKHSQDRVIGTKGDIA
HIYDIQTGNKLLTLFNPDLANNYKRNCATFNPTDDLVLNDGVLWDVRSAQAIHKFDKFNM
NISGVFHPNGLEVIINTEIWDLRTFHLLHTVPALDQCRVVFNHTGTVMYGAMLQADDEDD
LMEERMKSPFGSSFRTFNATDYKPIATIDVKRNIFDLCTDTKDCYLAVIENQGSMDALNM
DTVCRLYEVGRQRLAEDEDEEEDQEEEEQEEEDDDEDDDDTDDLDELDTDQLLEAELEED
DNNENAGEDGDNDFSPSDEELANLLEEGEDGEDEDSDADEEVELILGDTDSSDNSDLEDD
IILSLNE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7v7bA	0.455	0.611	0.000	1110	0.736	0.999	7v7bA.pdb.gz
2	AFDB:Q9Y4B6	1.000	1.000	0.000	1507	1.000	1.000	Q9Y4B6.pdb.gz	DCAF1_HUMAN DDB1- and CUL4-associated factor 1 OS=Homo sapiens OX=9606 GN=DCAF1 PE=1 SV=3
3	PDB:5mzhB	0.168	0.539	2.325E-12	415	0.040	0.147	5mzhB.pdb.gz
4	PDB:7zgrD	0.165	0.571	9.152E-11	395	0.039	0.149	7zgrD.pdb.gz	Mpe1 senses the binding of pre-mRNA and controls 3' end processing by CPF.
5	PDB:5nnzA	0.166	0.667	1.591E-10	335	0.038	0.173	5nnzA.pdb.gz
6	AFDB:C8V0I4	0.170	0.412	2.587E-10	574	0.064	0.169	C8V0I4.pdb.gz	C8V0I4_EMENI Transcriptional corepressor (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06505 PE=4 SV=1
7	PDB:5yzgs	0.172	0.640	3.946E-10	374	0.031	0.126	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
8	PDB:3jcmB	0.179	0.588	6.860E-10	429	0.031	0.107	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
9	PDB:7mq8LS	0.169	0.522	7.424E-10	453	0.033	0.108	7mq8LS.pdb.gz	Nucleolar maturation of the human small subunit processome.
10	PDB:2h9lA	0.164	0.692	7.723E-10	321	0.036	0.168	2h9lA.pdb.gz
11	PDB:7mq8LJ	0.168	0.508	8.358E-10	469	0.030	0.096	7mq8LJ.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7jvrB	0.165	0.649	9.045E-10	342	0.029	0.129	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
13	AFDB:P16649	0.158	0.308	1.031E-9	713	0.071	0.150	P16649.pdb.gz	TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TUP1 PE=1 SV=2
14	AFDB:U4PCM1	0.180	0.324	5.858E-9	809	0.060	0.111	U4PCM1.pdb.gz	WDR33_CAEEL pre-mRNA 3' end processing protein pfs-2 OS=Caenorhabditis elegans OX=6239 GN=pfs-2 PE=1 SV=2
15	AFDB:Q9FKR9	0.161	0.473	2.244E-8	472	0.042	0.136	Q9FKR9.pdb.gz	C3H59_ARATH Zinc finger CCCH domain-containing protein 59 OS=Arabidopsis thaliana OX=3702 GN=ZFWD3 PE=2 SV=1
16	AFDB:Q9C0J8	0.180	0.201	4.221E-8	1336	0.046	0.052	Q9C0J8.pdb.gz	WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2
17	AFDB:Q13409	0.164	0.361	8.593E-8	638	0.053	0.125	Q13409.pdb.gz	DC1I2_HUMAN Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3
18	AFDB:B5MBZ0	0.069	0.095	5.952E-7	992	0.074	0.113	B5MBZ0.pdb.gz	B5MBZ0_HUMAN EMAP like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
19	AFDB:O75717	0.161	0.211	1.419E-6	1129	0.037	0.050	O75717.pdb.gz	WDHD1_HUMAN WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=WDHD1 PE=1 SV=1
20	AFDB:Q9H967	0.170	0.380	8.392E-6	626	0.047	0.113	Q9H967.pdb.gz	WDR76_HUMAN WD repeat-containing protein 76 OS=Homo sapiens OX=9606 GN=WDR76 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80TR8	0.0	3078	1506	0.983	0.983	DCAF1_MOUSE DDB1- and CUL4-associated factor 1 OS=Mus musculus OX=10090 GN=Dcaf1 PE=1 SV=4
2	Q9W2F2	0.0	924	1544	0.366	0.357	DCAF1_DROME Protein mahjong OS=Drosophila melanogaster OX=7227 GN=mahj PE=1 SV=2
3	Q9Y4B6	0.0	3136	1507	1.000	1.000	DCAF1_HUMAN DDB1- and CUL4-associated factor 1 OS=Homo sapiens OX=9606 GN=DCAF1 PE=1 SV=3
4	Q9M086	1.62e-65	248	1883	0.104	0.083	DCAF1_ARATH DDB1- and CUL4-associated factor homolog 1 OS=Arabidopsis thaliana OX=3702 GN=DCAF1 PE=1 SV=2
5	Q386J2	9.74e-21	102	1650	0.060	0.055	Q386J2_TRYB2 LisH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0690 PE=3 SV=1
6	Q3Y8L7	1.54e-07	58.2	446	0.041	0.139	DAW1_CHLRE Dynein assembly factor with WD repeat domains 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DAW1 PE=1 SV=1
7	Q94BR4	9.12e-06	52.8	523	0.035	0.099	PR19A_ARATH Pre-mRNA-processing factor 19 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=PRP19A PE=1 SV=1
8	A2CEH0	8.56e-05	49.3	490	0.035	0.108	POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio OX=7955 GN=poc1b PE=2 SV=1
9	O22785	7.46e-04	46.6	525	0.031	0.090	PR19B_ARATH Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=PRP19B PE=1 SV=3
10	Q9UTC7	0.001	45.8	462	0.039	0.128	YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC227.12 PE=4 SV=1
11	A0MNP2	0.004	43.5	357	0.030	0.126	A0MNP2_HUMAN CDW11/WDR57 OS=Homo sapiens OX=9606 GN=WDR57 PE=2 SV=1
12	Q96DI7	0.004	43.5	357	0.030	0.126	SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP40 PE=1 SV=1
13	H0YN81	0.006	43.1	294	0.033	0.170	H0YN81_HUMAN SKI8 subunit of superkiller complex (Fragment) OS=Homo sapiens OX=9606 GN=SKIC8 PE=1 SV=1
14	Q9GZS3	0.007	42.7	305	0.033	0.164	SKI8_HUMAN Superkiller complex protein 8 OS=Homo sapiens OX=9606 GN=SKIC8 PE=1 SV=1
15	Q9ERF3	0.008	42.7	305	0.034	0.167	SKI8_MOUSE Superkiller complex protein 8 OS=Mus musculus OX=10090 GN=Skic8 PE=1 SV=1
16	Q7SYN5	0.015	42.0	471	0.020	0.064	RXRBA_DANRE Retinoic acid receptor RXR-beta-A OS=Danio rerio OX=7955 GN=rxrba PE=2 SV=1
17	Q05048	0.023	41.6	431	0.031	0.107	CSTF1_HUMAN Cleavage stimulation factor subunit 1 OS=Homo sapiens OX=9606 GN=CSTF1 PE=1 SV=1
18	Q10272	0.035	40.8	446	0.028	0.094	IPI3_SCHPO Pre-rRNA-processing protein crb3/ipi3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=crb3 PE=1 SV=1
19	Q6PH45	0.055	40.4	507	0.033	0.097	Q6PH45_DANRE PRP4 pre-mRNA-processing factor 4 homolog (yeast) OS=Danio rerio OX=7955 GN=mg:ab03a02 PE=1 SV=1
20	Q9NDJ2	0.11	39.7	3198	0.021	0.010	DOM_DROME Helicase domino OS=Drosophila melanogaster OX=7227 GN=dom PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	1.4e+02	14.2	Anaphase-promoting complex subunit 4 WD40 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010379898.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010383247.1	0.999	Damage specific DNA binding protein 1
2	61622.XP_010358365.1	0.998	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
3	61622.XP_010353041.1	0.997	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
4	61622.XP_010359755.1	0.989	DET1- and DDB1-associated protein 1
5	61622.XP_010370083.1	0.979	DDB1 and CUL4 associated factor 6
6	61622.XP_010378689.1	0.979	WD and tetratricopeptide repeats 1
7	61622.XP_010370787.1	0.965	Denticleless E3 ubiquitin protein ligase homolog
8	61622.XP_010358774.1	0.955	Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine
9	61622.XP_010357711.1	0.953	Neurofibromin 2
10	61622.XP_010353620.1	0.947	SAM and HD domain containing deoxynucleoside triphosphate triphosphohydrolase 1
11	61622.XP_010375845.1	0.945	Ring-box 1
12	61622.XP_010369398.1	0.936	Damage specific DNA binding protein 2
13	61622.XP_010359898.1	0.922	DDB1 and CUL4 associated factor 15
14	61622.XP_010370992.1	0.921	F-box and WD repeat domain containing 5
15	61622.XP_010352825.1	0.918	DDB1 and CUL4 associated factor 13
16	61622.XP_010362090.1	0.918	DDB1- and CUL4-associated factor 11 isoform X1
17	61622.XP_010360600.1	0.916	DET1 homolog isoform X1
18	61622.XP_010363826.1	0.903	Dual specificity tyrosine-phosphorylation-regulated kinase 2
19	61622.XP_010368297.1	0.893	DDB1 and CUL4 associated factor 10
20	61622.XP_010369895.1	0.890	COP9 signalosome complex subunit 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030331	1.000	nuclear estrogen receptor binding
GO:1990244	1.000	histone H2AT120 kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.994	primary metabolic process
GO:0006807	0.991	nitrogen compound metabolic process
GO:0043170	0.991	macromolecule metabolic process
GO:0009987	0.988	cellular process
GO:0050789	0.979	regulation of biological process
GO:0044237	0.977	cellular metabolic process
GO:0046483	0.970	heterocycle metabolic process
GO:0006259	0.952	DNA metabolic process
GO:0050794	0.942	regulation of cellular process
GO:0019222	0.933	regulation of metabolic process
GO:0036211	0.916	protein modification process
GO:0060255	0.905	regulation of macromolecule metabolic process
GO:0080090	0.899	regulation of primary metabolic process
GO:0031323	0.892	regulation of cellular metabolic process
GO:0051171	0.881	regulation of nitrogen compound metabolic process
GO:0006310	0.864	DNA recombination
GO:0048523	0.857	negative regulation of cellular process
GO:0019219	0.817	regulation of nucleobase-containing compound metabolic process
GO:0002521	0.755	leukocyte differentiation
GO:0032501	0.730	multicellular organismal process
GO:0002520	0.718	immune system development
GO:0046649	0.713	lymphocyte activation
GO:0002200	0.709	somatic diversification of immune receptors
GO:0016444	0.709	somatic cell DNA recombination
GO:0010468	0.696	regulation of gene expression
GO:1903131	0.682	mononuclear cell differentiation
GO:0051172	0.649	negative regulation of nitrogen compound metabolic process
GO:0031324	0.647	negative regulation of cellular metabolic process
GO:0010605	0.612	negative regulation of macromolecule metabolic process
GO:0031326	0.585	regulation of cellular biosynthetic process
GO:0010556	0.579	regulation of macromolecule biosynthetic process
GO:0042113	0.579	B cell activation
GO:0051252	0.575	regulation of RNA metabolic process
GO:2001141	0.572	regulation of RNA biosynthetic process
GO:0030098	0.486	lymphocyte differentiation
GO:0002562	0.455	somatic diversification of immune receptors via germline recombination within a single locus
GO:0050896	0.431	response to stimulus
GO:0045934	0.431	negative regulation of nucleobase-containing compound metabolic process
GO:0006355	0.369	regulation of DNA-templated transcription
GO:0048518	0.363	positive regulation of biological process
GO:0006357	0.357	regulation of transcription by RNA polymerase II
GO:0043687	0.353	post-translational protein modification
GO:0030183	0.329	B cell differentiation
GO:1902679	0.325	negative regulation of RNA biosynthetic process
GO:0045892	0.309	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0080008	0.999	Cul4-RING E3 ubiquitin ligase complex
GO:0140513	0.997	nuclear protein-containing complex
GO:0008180	0.994	COP9 signalosome
GO:0005730	0.992	nucleolus
GO:0001650	0.983	fibrillar center
GO:0005829	0.810	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]