StarFunc result for job id Q9Y4C0

User Input

>input (1643 residues)
MSSTLHSVFFTLKVSILLGSLLGLCLGLEFMGLPNQWARYLRWDASTRSDLSFQFKTNVS
TGLLLYLDDGGVCDFLCLSLVDGRVQLRFSMDCAETAVLSNKQVNDSSWHFLMVSRDRLR
TVLMLDGEGQSGELQPQRPYMDVVSDLFLGGVPTDIRPSALTLDGVQAMPGFKGLILDLK
YGNSEPRLLGSRGVQMDAEGPCGERPCENGGICFLLDGHPTCDCSTTGYGGKLCSEDVSQ
DPGLSHLMMSEQAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTG
KSADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNAWHDVKVTRNLRQVTISVDG
ILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELS
RLARIADTKMKIYGEVVFKCENVATLDPINFETPEAYISLPKWNTKRMGSISFDFRTTEP
NGLILFTHGKPQERKDARSQKNTKVDFFAVELLDGNLYLLLDMGSGTIKVKATQKKANDG
EWYHVDIQRDGRSGTISVNSRRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWT
AMLNYGYVGCIRDLFIDGRSKNIRQLAEMQNAAGVKSSCSRMSAKQCDSYPCKNNAVCKD
GWNRFICDCTGTGYWGRTCEREASILSYDGSMYMKIIMPMVMHTEAEDVSFRFMSQRAYG
LLVATTSRDSADTLRLELDGGRVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVR
VVRRGKSLKLTVDDDVAEGTMVGDHTRLEFHNIETGIMTEKRYISVVPSSFIGHLQSLMF
NGLLYIDLCKNGDIDYCELKARFGLRNIIADPVTFKTKSSYLSLATLQAYTSMHLFFQFK
TTSPDGFILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSDRPLNDNQWHNVVIT
RDNSNTHSLKVDTKVVTQVINGAKNLDLKGDLYMAGLAQGMYSNLPKLVASRDGFQGCLA
SVDLNGRLPDLINDALHRSGQIERGCEGPSTTCQEDSCANQGVCMQQWEGFTCDCSMTSY
SGNQCNDPGATYIFGKSGGLILYTWPANDRPSTRSDRLAVGFSTTVKDGILVRIDSAPGL
GDFLQLHIEQGKIGVVFNIGTVDISIKEERTPVNDGKYHVVRFTRNGGNATLQVDNWPVN
EHYPTGRQLTIFNTQAQIAIGGKDKGRLFQGQLSGLYYDGLKVLNMAAENNPNIKINGSV
RLVGEVPSILGTTQTTSMPPEMSTTVMETTTTMATTTTRKNRSTASIQPTSDDLVSSAEC
SSDDEDFVECEPSTTGGELVIPLLVEDPLATPPIATRAPSITLPPTFRPLLTIIETTKDS
LSMTSEAGLPCLSDQGSDGCDDDGLVISGYGSGETFDSNLPPTDDEDFYTTFSLVTDKSL
STSIFEGGYKAHAPKWESKDFRPNKVSETSRTTTTSLSPELIRFTASSSSGMVPKLPAGK
MNNRDLKPQPDIVLLPLPTAYELDSTKLKSPLITSPMFRNVPTANPTEPGIRRVPGASEV
IRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDETRNYISNSAQSNGTLM
KEKQQSSKSGHKKQKNKDREYYV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P9K9	0.706	0.736	0.000	1571	0.920	0.962	Q6P9K9.pdb.gz	NRX3A_MOUSE Neurexin-3 OS=Mus musculus OX=10090 GN=Nrxn3 PE=1 SV=2
2	AFDB:Q9Y4C0	1.000	1.000	0.000	1643	1.000	1.000	Q9Y4C0.pdb.gz	NRX3A_HUMAN Neurexin-3 OS=Homo sapiens OX=9606 GN=NRXN3 PE=1 SV=4
3	AFDB:F1R8J2	0.106	0.092	2.127E-21	2014	0.143	0.117	F1R8J2.pdb.gz
4	AFDB:Q5QNQ9	0.072	0.065	1.966E-6	1845	0.052	0.047	Q5QNQ9.pdb.gz	CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus OX=10090 GN=Col27a1 PE=2 SV=1
5	AFDB:Q8IZC6	0.083	0.074	4.367E-6	1860	0.060	0.053	Q8IZC6.pdb.gz	CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens OX=9606 GN=COL27A1 PE=1 SV=1
6	PDB:3v0aB	0.082	0.114	5.954E-6	1150	0.026	0.037	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
7	PDB:4pbpB	0.089	0.599	1.323E-5	210	0.018	0.143	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
8	PDB:2a3wA	0.088	0.620	1.925E-5	204	0.022	0.176	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.
9	PDB:7uknA	0.051	0.066	2.435E-5	1059	0.073	0.113	7uknA.pdb.gz	Insight into Viral Hijacking of CRL4 Ubiquitin Ligase through Structural Analysis of the pUL145-DDB1 Complex.
10	PDB:7zl1A	0.088	0.584	3.382E-5	215	0.021	0.163	7zl1A.pdb.gz
11	PDB:6m5yA	0.068	0.316	3.545E-5	270	0.023	0.141	6m5yA.pdb.gz	Crystal structure and conformational stability of a galectin-1 tandem-repeat mutant with a short linker.
12	PDB:7tzcA	0.069	0.035	5.161E-5	4404	0.047	0.018	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
13	PDB:5hxbY	0.050	0.065	7.169E-5	1080	0.075	0.114	5hxbY.pdb.gz	A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.
14	PDB:3ffzA	0.074	0.095	9.958E-5	1246	0.023	0.030	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
15	PDB:5jowA	0.070	0.179	1.669E-4	504	0.040	0.129	5jowA.pdb.gz
16	AFDB:A0A2R8QRK0	0.043	0.048	5.006E-4	1420	0.094	0.108	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
17	AFDB:F1R2D2	0.045	0.045	9.660E-4	1687	0.101	0.098	F1R2D2.pdb.gz
18	AFDB:Q96MS0	0.042	0.046	1.545E-3	1386	0.099	0.118	Q96MS0.pdb.gz	ROBO3_HUMAN Roundabout homolog 3 OS=Homo sapiens OX=9606 GN=ROBO3 PE=1 SV=2
19	AFDB:P41950	0.055	0.069	3.124E-3	1137	0.074	0.106	P41950.pdb.gz	DEX1_CAEEL Dendrite extension defective protein 1 OS=Caenorhabditis elegans OX=6239 GN=dex-1 PE=2 SV=3
20	AFDB:E9Q0S6	0.035	0.032	1.059E-2	1888	0.052	0.045	E9Q0S6.pdb.gz	TENS1_MOUSE Tensin-1 OS=Mus musculus OX=10090 GN=Tns1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KGL0	873	1847	0.314	0.279	A0A0B4KGL0_DROME Neurexin 1, isoform F OS=Drosophila melanogaster OX=7227 GN=Nrx-1 PE=4 SV=1
2	A0A0B4KGQ3	863	1825	0.310	0.279	A0A0B4KGQ3_DROME Neurexin 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Nrx-1 PE=4 SV=1
3	A0A0B4KH61	868	1525	0.313	0.338	A0A0B4KH61_DROME Neurexin 1, isoform G OS=Drosophila melanogaster OX=7227 GN=Nrx-1 PE=4 SV=1
4	A0A0R4J2G7	1945	1495	0.581	0.638	A0A0R4J2G7_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
5	A0A1D5RMU6	1940	1499	0.581	0.636	A0A1D5RMU6_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
6	A1XQX0	1867	1491	0.559	0.616	NR1AA_DANRE Neurexin-1a OS=Danio rerio OX=7955 GN=nrxn1a PE=2 SV=1
7	A1XQX4	1968	1670	0.609	0.599	A1XQX4_DANRE Neurexin 2a alpha OS=Danio rerio OX=7955 GN=nrxn2a PE=2 SV=1
8	D0PRN4	1025	668	0.323	0.795	NRX3B_CHICK Neurexin-3-beta OS=Gallus gallus OX=9031 GN=NRXN3 PE=1 SV=2
9	E7ERL8	1930	1507	0.581	0.633	E7ERL8_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
10	E9Q7X7	2111	1710	0.653	0.627	NRX2A_MOUSE Neurexin-2 OS=Mus musculus OX=10090 GN=Nrxn2 PE=1 SV=1
11	P58401	574	666	0.206	0.508	NRX2B_HUMAN Neurexin-2-beta OS=Homo sapiens OX=9606 GN=NRXN2 PE=1 SV=1
12	Q28146	1922	1530	0.581	0.624	NRX1A_BOVIN Neurexin-1 OS=Bos taurus OX=9913 GN=NRXN1 PE=1 SV=1
13	Q3KN41	869	1840	0.314	0.280	NRX1_DROME Neurexin 1 OS=Drosophila melanogaster OX=7227 GN=Nrx-1 PE=1 SV=1
14	Q63372	1930	1530	0.581	0.624	NRX1A_RAT Neurexin-1 OS=Rattus norvegicus OX=10116 GN=Nrxn1 PE=1 SV=3
15	Q6P9K9	2723	1571	0.796	0.833	NRX3A_MOUSE Neurexin-3 OS=Mus musculus OX=10090 GN=Nrxn3 PE=1 SV=2
16	Q9CS84	1932	1514	0.581	0.630	NRX1A_MOUSE Neurexin-1 OS=Mus musculus OX=10090 GN=Nrxn1 PE=1 SV=3
17	Q9HDB5	1127	637	0.337	0.870	NRX3B_HUMAN Neurexin-3-beta OS=Homo sapiens OX=9606 GN=NRXN3 PE=1 SV=4
18	Q9P2S2	2109	1712	0.655	0.629	NRX2A_HUMAN Neurexin-2 OS=Homo sapiens OX=9606 GN=NRXN2 PE=2 SV=1
19	Q9ULB1	1948	1477	0.581	0.646	NRX1A_HUMAN Neurexin-1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
20	Q9VCZ9	872	1837	0.315	0.281	Q9VCZ9_DROME Neurexin 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Nrx-1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06439 3keto-disac_hyd	0.31	22.7	3-keto-disaccharide hydrolase
2	PF02656 DUF202	3e+02	13.3	Domain of unknown function (DUF202)
3	PF00008 EGF	4.2e-08	44.6	EGF-like domain
4	PF12661 hEGF	6.2	18.8	Human growth factor-like EGF
5	PF00054 Laminin_G_1	4.3e-109	371.6	Laminin G domain
6	PF02210 Laminin_G_2	2.2e-155	521.2	Laminin G domain
7	PF13385 Laminin_G_3	3.6e-23	93.8	Concanavalin A-like lectin/glucanases superfamily
8	PF10247 Romo1	3.6e+02	13.0	Reactive mitochondrial oxygen species modulator 1
9	PF01034 Syndecan	0.01	27.1	Syndecan domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000045254

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000057890	0.886	Neuroligin 1
2	9598.ENSPTRP00000053144	0.872	Uncharacterized protein
3	9598.ENSPTRP00000014780	0.865	Uncharacterized protein
4	9598.ENSPTRP00000020795	0.860	Uncharacterized protein
5	9598.ENSPTRP00000029568	0.839	Leucine rich repeat transmembrane neuronal 2
6	9598.ENSPTRP00000037835	0.832	Uncharacterized protein
7	9598.ENSPTRP00000047442	0.824	Calcium/calmodulin-dependent serine protein kinase (MAGUK family)
8	9598.ENSPTRP00000040508	0.811	Erythrocyte membrane protein band 4.1
9	9598.ENSPTRP00000006892	0.802	SH3 and multiple ankyrin repeat domains 2
10	9598.ENSPTRP00000040734	0.790	Uncharacterized protein
11	9598.ENSPTRP00000045926	0.790	Neuroligin 4, Y-linked
12	9598.ENSPTRP00000032347	0.778	Neurexophilin
13	9598.ENSPTRP00000004388	0.705	Uncharacterized protein
14	9598.ENSPTRP00000004348	0.700	Ankyrin 3, node of Ranvier (ankyrin G)
15	9598.ENSPTRP00000059231	0.695	Uncharacterized protein
16	9598.ENSPTRP00000020782	0.682	Uncharacterized protein
17	9598.ENSPTRP00000010504	0.681	Uncharacterized protein
18	9598.ENSPTRP00000035905	0.670	Amyloid beta (A4) precursor protein-binding, family A, member 1
19	9598.ENSPTRP00000025092	0.661	SH3 and multiple ankyrin repeat domains 3
20	9598.ENSPTRP00000013823	0.659	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.996	molecular function regulator activity
GO:0038023	0.996	signaling receptor activity
GO:0005102	0.994	signaling receptor binding
GO:0099106	0.989	ion channel regulator activity
GO:0005246	0.972	calcium channel regulator activity
GO:0050839	0.968	cell adhesion molecule binding
GO:0097109	0.534	neuroligin family protein binding
GO:0043167	0.458	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071840	0.989	cellular component organization or biogenesis
GO:0032501	0.985	multicellular organismal process
GO:0007399	0.980	nervous system development
GO:0016043	0.974	cellular component organization
GO:0051179	0.937	localization
GO:0050896	0.931	response to stimulus
GO:0050789	0.918	regulation of biological process
GO:0050794	0.907	regulation of cellular process
GO:0034329	0.905	cell junction assembly
GO:0098609	0.876	cell-cell adhesion
GO:0009653	0.876	anatomical structure morphogenesis
GO:0050808	0.866	synapse organization
GO:0031175	0.863	neuron projection development
GO:0065008	0.859	regulation of biological quality
GO:0048858	0.858	cell projection morphogenesis
GO:0040011	0.850	locomotion
GO:0035176	0.845	social behavior
GO:0007612	0.844	learning
GO:0007416	0.830	synapse assembly
GO:0048812	0.825	neuron projection morphogenesis
GO:0023052	0.807	signaling
GO:0030534	0.771	adult behavior
GO:0007154	0.761	cell communication
GO:0061564	0.754	axon development
GO:0042221	0.743	response to chemical
GO:0048667	0.741	cell morphogenesis involved in neuron differentiation
GO:0010646	0.733	regulation of cell communication
GO:0023051	0.715	regulation of signaling
GO:0009605	0.688	response to external stimulus
GO:0007268	0.637	chemical synaptic transmission
GO:0033036	0.605	macromolecule localization
GO:0051641	0.605	cellular localization
GO:0051234	0.602	establishment of localization
GO:0008104	0.595	protein localization
GO:0099177	0.583	regulation of trans-synaptic signaling
GO:0006810	0.560	transport
GO:0048518	0.553	positive regulation of biological process
GO:0050804	0.548	modulation of chemical synaptic transmission
GO:0048522	0.491	positive regulation of cellular process
GO:0007409	0.472	axonogenesis
GO:0042330	0.465	taxis
GO:0051239	0.463	regulation of multicellular organismal process
GO:0099173	0.463	postsynapse organization
GO:0007411	0.439	axon guidance
GO:0032879	0.402	regulation of localization
GO:0051128	0.389	regulation of cellular component organization
GO:1902414	0.388	protein localization to cell junction
GO:0048583	0.365	regulation of response to stimulus
GO:0035418	0.362	protein localization to synapse
GO:0099172	0.356	presynapse organization
GO:0006996	0.303	organelle organization
GO:0072657	0.302	protein localization to membrane
GO:0051049	0.301	regulation of transport
GO:0009966	0.300	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0043227	0.978	membrane-bounded organelle
GO:0030054	0.977	cell junction
GO:0043229	0.976	intracellular organelle
GO:0045202	0.972	synapse
GO:0043228	0.947	non-membrane-bounded organelle
GO:0043232	0.936	intracellular non-membrane-bounded organelle
GO:0043231	0.816	intracellular membrane-bounded organelle
GO:0042995	0.795	cell projection
GO:0043005	0.793	neuron projection
GO:0005634	0.691	nucleus
GO:0043233	0.637	organelle lumen
GO:0070013	0.634	intracellular organelle lumen
GO:0031981	0.546	nuclear lumen
GO:0098978	0.527	glutamatergic synapse
GO:0098794	0.414	postsynapse
GO:0036477	0.395	somatodendritic compartment
GO:0030424	0.386	axon

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]