StarFunc result for job id Q9Y4C1

User Input

>input (1321 residues)
MVLTLGESWPVLVGRRFLSLSAADGSDGSHDSWDVERVAEWPWLSGTIRAVSHTDVTKKD
LKVCVEFDGESWRKRRWIEVYSLLRRAFLVEHNLVLAERKSPEISERIVQWPAITYKPLL
DKAGLGSITSVRFLGDQQRVFLSKDLLKPIQDVNSLRLSLTDNQIVSKEFQALIVKHLDE
SHLLKGDKNLVGSEVKIYSLDPSTQWFSATVINGNPASKTLQVNCEEIPALKIVDPSLIH
VEVVHDNLVTCGNSARIGAVKRKSSENNGTLVSKQAKSCSEASPSMCPVQSVPTTVFKEI
LLGCTAATPPSKDPRQQSTPQAANSPPNLGAKIPQGCHKQSLPEEISSCLNTKSEALRTK
PDVCKAGLLSKSSQIGTGDLKILTEPKGSCTQPKTNTDQENRLESVPQALTGLPKECLPT
KASSKAELEIANPPELQKHLEHAPSPSDVSNAPEVKAGVNSDSPNNCSGKKVEPSALACR
SQNLKESSVKVDNESCCSRSNNKIQNAPSRKSVLTDPAKLKKLQQSGEAFVQDDSCVNIV
AQLPKCRECRLDSLRKDKEQQKDSPVFCRFFHFRRLQFNKHGVLRVEGFLTPNKYDNEAI
GLWLPLTKNVVGIDLDTAKYILANIGDHFCQMVISEKEAMSTIEPHRQVAWKRAVKGVRE
MCDVCDTTIFNLHWVCPRCGFGVCVDCYRMKRKNCQQGAAYKTFSWLKCVKSQIHEPENL
MPTQIIPGKALYDVGDIVHSVRAKWGIKANCPCSNRQFKLFSKPASKEDLKQTSLAGEKP
TLGAVLQQNPSVLEPAAVGGEAASKPAGSMKPACPASTSPLNWLADLTSGNVNKENKEKQ
PTMPILKNEIKCLPPLPPLSKSSTVLHTFNSTILTPVSNNNSGFLRNLLNSSTGKTENGL
KNTPKILDDIFASLVQNKTTSDLSKRPQGLTIKPSILGFDTPHYWLCDNRLLCLQDPNNK
SNWNVFRECWKQGQPVMVSGVHHKLNSELWKPESFRKEFGEQEVDLVNCRTNEIITGATV
GDFWDGFEDVPNRLKNEKEPMVLKLKDWPPGEDFRDMMPSRFDDLMANIPLPEYTRRDGK
LNLASRLPNYFVRPDLGPKMYNAYGLITPEDRKYGTTNLHLDVSDAANVMVYVGIPKGQC
EQEEEVLKTIQDGDSDELTIKRFIEGKEKPGALWHIYAAKDTEKIREFLKKVSEEQGQEN
PADHDPIHDQSWYLDRSLRKRLHQEYGVQGWAIVQFLGDVVFIPAGAPHQVHNLYSCIKV
AEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIYHAVKDAVAMLKASESSFGK
P

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PCM1	0.859	0.858	0.000	1323	0.914	0.913	Q6PCM1.pdb.gz	KDM3A_MOUSE Lysine-specific demethylase 3A OS=Mus musculus OX=10090 GN=Kdm3a PE=1 SV=1
2	AFDB:A0A0R4IYD2	0.476	0.249	2.856E-84	2557	0.343	0.177	A0A0R4IYD2.pdb.gz
3	AFDB:Q69ZK6	0.468	0.266	1.149E-81	2350	0.328	0.184	Q69ZK6.pdb.gz	JHD2C_MOUSE Probable JmjC domain-containing histone demethylation protein 2C OS=Mus musculus OX=10090 GN=Jmjd1c PE=1 SV=3
4	AFDB:Q15652	0.469	0.248	5.348E-80	2540	0.327	0.170	Q15652.pdb.gz	JHD2C_HUMAN Probable JmjC domain-containing histone demethylation protein 2C OS=Homo sapiens OX=9606 GN=JMJD1C PE=1 SV=2
5	AFDB:G3V9U4	0.173	0.169	5.452E-9	1356	0.111	0.108	G3V9U4.pdb.gz	G3V9U4_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6b PE=3 SV=4
6	PDB:3al5B	0.147	0.543	2.572E-7	311	0.031	0.132	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
7	PDB:4qszA	0.153	0.276	1.314E-6	686	0.036	0.070	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
8	PDB:5nfnB	0.134	0.469	3.387E-6	318	0.033	0.135	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
9	PDB:3al5C	0.139	0.547	7.073E-6	284	0.032	0.148	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
10	PDB:7yxgA	0.135	0.456	1.136E-5	313	0.031	0.131	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
11	PDB:4b7eA	0.144	0.457	2.811E-4	349	0.028	0.106	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
12	PDB:2ns2B	0.053	0.281	6.875E-4	172	0.021	0.163	2ns2B.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
13	AFDB:Q6FUW3	0.066	0.078	7.942E-4	975	0.095	0.129	Q6FUW3.pdb.gz	Q6FUW3_CANGA Candida glabrata strain CBS138 chromosome E complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EPA3 PE=4 SV=1
14	PDB:7okyZ	0.038	0.120	2.460E-2	374	0.018	0.064	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
15	PDB:6nieA	0.111	0.444	2.593E-2	244	0.026	0.139	6nieA.pdb.gz	A family of radical halogenases for the engineering of amino-acid-based products.
16	AFDB:O14976	0.039	0.039	2.696E-2	1311	0.089	0.089	O14976.pdb.gz	GAK_HUMAN Cyclin-G-associated kinase OS=Homo sapiens OX=9606 GN=GAK PE=1 SV=2
17	AFDB:Q8K1M4	0.043	0.062	2.696E-2	789	0.082	0.137	Q8K1M4.pdb.gz	GLIS1_MOUSE Zinc finger protein GLIS1 OS=Mus musculus OX=10090 GN=Glis1 PE=1 SV=2
18	AFDB:Q9D8C3	0.057	0.063	3.896E-2	1166	0.070	0.079	Q9D8C3.pdb.gz	ALG13_MOUSE Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Mus musculus OX=10090 GN=Alg13 PE=1 SV=2
19	AFDB:Q8JGS1	0.046	0.048	4.809E-2	1263	0.092	0.096	Q8JGS1.pdb.gz	STIL_DANRE SCL-interrupting locus protein homolog OS=Danio rerio OX=7955 GN=stil PE=1 SV=2
20	PDB:4bxfA	0.129	0.343	8.694E-2	425	0.026	0.080	4bxfA.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZXX2	0.0	1067	1762	0.400	0.300	A0A8I5ZXX2_RAT Lysine-specific demethylase OS=Rattus norvegicus OX=10116 GN=Kdm3b PE=3 SV=1
2	A0A8I6AC36	0.0	1064	1562	0.399	0.337	A0A8I6AC36_RAT Lysine-specific demethylase OS=Rattus norvegicus OX=10116 GN=Kdm3b PE=1 SV=1
3	M0RDF1	0.0	1067	1724	0.400	0.306	M0RDF1_RAT Lysine-specific demethylase OS=Rattus norvegicus OX=10116 GN=Kdm3b PE=1 SV=2
4	Q15652	0.0	762	2540	0.304	0.158	JHD2C_HUMAN Probable JmjC domain-containing histone demethylation protein 2C OS=Homo sapiens OX=9606 GN=JMJD1C PE=1 SV=2
5	Q63679	0.0	2265	1214	0.831	0.904	KDM3A_RAT Lysine-specific demethylase 3A OS=Rattus norvegicus OX=10116 GN=Kdm3a PE=2 SV=1
6	Q69ZK6	0.0	744	2350	0.297	0.167	JHD2C_MOUSE Probable JmjC domain-containing histone demethylation protein 2C OS=Mus musculus OX=10090 GN=Jmjd1c PE=1 SV=3
7	Q6PCM1	0.0	2499	1323	0.916	0.915	KDM3A_MOUSE Lysine-specific demethylase 3A OS=Mus musculus OX=10090 GN=Kdm3a PE=1 SV=1
8	Q7LBC6	0.0	1070	1761	0.398	0.299	KDM3B_HUMAN Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2
9	Q9Y4C1	0.0	2734	1321	1.000	1.000	KDM3A_HUMAN Lysine-specific demethylase 3A OS=Homo sapiens OX=9606 GN=KDM3A PE=1 SV=4
10	Q9VHC5	8.83e-133	431	854	0.161	0.249	Q9VHC5_DROME JmjC domain-containing histone demethylase 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Kdm3 PE=2 SV=1
11	C0SUU8	2.80e-61	229	875	0.097	0.146	JMJ26_ARATH Lysine-specific demethylase JMJ26 OS=Arabidopsis thaliana OX=3702 GN=JMJ26 PE=2 SV=1
12	C0SV12	7.44e-57	216	883	0.099	0.148	JMJ29_ARATH Lysine-specific demethylase JMJ29 OS=Arabidopsis thaliana OX=3702 GN=JMJ29 PE=2 SV=1
13	Q9SSE9	5.80e-55	211	1027	0.099	0.128	JMJ25_ARATH Lysine-specific demethylase JMJ25 OS=Arabidopsis thaliana OX=3702 GN=JMJ25 PE=1 SV=1
14	F4JFK4	1.27e-49	194	1049	0.099	0.125	F4JFK4_ARATH Transcription factor jumonji (JmjC) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=IBM1 PE=1 SV=1
15	O43593	1.14e-44	179	1189	0.100	0.111	HAIR_HUMAN Lysine-specific demethylase hairless OS=Homo sapiens OX=9606 GN=HR PE=1 SV=5
16	Q61645	7.80e-44	176	1182	0.090	0.101	HAIR_MOUSE Lysine-specific demethylase hairless OS=Mus musculus OX=10090 GN=Hr PE=2 SV=2
17	P97609	2.22e-43	175	1181	0.092	0.102	HAIR_RAT Lysine-specific demethylase hairless OS=Rattus norvegicus OX=10116 GN=Hr PE=1 SV=2
18	Q8VYB9	2.64e-30	132	840	0.053	0.083	JMJ27_ARATH Lysine-specific demethylase JMJ27 OS=Arabidopsis thaliana OX=3702 GN=JMJ27 PE=1 SV=1
19	F4HZD1	2.46e-26	119	944	0.072	0.101	JMJ24_ARATH E3 ubiquitin-protein ligase JMJ24 OS=Arabidopsis thaliana OX=3702 GN=JMJ24 PE=1 SV=1
20	Q8H1S7	1.59e-22	107	927	0.079	0.112	JMJ28_ARATH Lysine-specific demethylase JMJ28 OS=Arabidopsis thaliana OX=3702 GN=JMJ28 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03107 C1_2	41	15.9	C1 domain
2	PF02373 JmjC	2.6e-14	65.0	JmjC domain, hydroxylase
3	PF14569 zf-UDP	5.3e+02	12.2	Zinc-binding RING-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386660

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287820	0.993	Peroxisome proliferator-activated receptor gamma
2	9606.ENSP00000347847	0.931	MKL/myocardin-like protein 1
3	9606.ENSP00000361473	0.915	Lysine-specific demethylase 4A
4	9606.ENSP00000354995	0.900	ATP-binding cassette sub-family G member 1
5	9606.ENSP00000437955	0.891	Hypoxia-inducible factor 1-alpha
6	9606.ENSP00000383042	0.890	Lysine-specific histone demethylase 1A
7	9606.ENSP00000363822	0.888	Androgen receptor
8	9606.ENSP00000395654	0.869	Transcription activator BRG1
9	9606.ENSP00000326563	0.821	Lysine-specific demethylase 3B
10	9606.ENSP00000297792	0.814	Lysine-specific histone demethylase 1B
11	9606.ENSP00000310515	0.810	Sperm protamine P1
12	9606.ENSP00000370710	0.807	Lysine-specific demethylase 4C
13	9606.ENSP00000442382	0.807	Lysine-specific demethylase 4C
14	9606.ENSP00000309591	0.804	cAMP-dependent protein kinase catalytic subunit alpha
15	9606.ENSP00000359719	0.804	cAMP-dependent protein kinase catalytic subunit beta
16	9606.ENSP00000366488	0.804	cAMP-dependent protein kinase catalytic subunit gamma
17	9606.ENSP00000159111	0.778	Lysine-specific demethylase 4B
18	9606.ENSP00000380692	0.769	Lysine-specific demethylase 7A
19	9606.ENSP00000320485	0.767	AT-rich interactive domain-containing protein 1A
20	9606.ENSP00000379003	0.767	Nuclear protein 1, transcriptional regulator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0032454	0.999	histone H3K9 demethylase activity
GO:0140110	0.987	transcription regulator activity
GO:0003712	0.983	transcription coregulator activity
GO:0003682	0.980	chromatin binding
GO:0008134	0.396	transcription factor binding
GO:0003676	0.351	nucleic acid binding
GO:0003677	0.332	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0010468	0.986	regulation of gene expression
GO:0051173	0.980	positive regulation of nitrogen compound metabolic process
GO:0019219	0.975	regulation of nucleobase-containing compound metabolic process
GO:0050896	0.963	response to stimulus
GO:0010604	0.945	positive regulation of macromolecule metabolic process
GO:0006355	0.945	regulation of DNA-templated transcription
GO:0048522	0.940	positive regulation of cellular process
GO:0031325	0.915	positive regulation of cellular metabolic process
GO:0045935	0.910	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.904	positive regulation of biosynthetic process
GO:0031328	0.879	positive regulation of cellular biosynthetic process
GO:0010557	0.877	positive regulation of macromolecule biosynthetic process
GO:0045893	0.873	positive regulation of DNA-templated transcription
GO:0051716	0.827	cellular response to stimulus
GO:0042221	0.756	response to chemical
GO:0032501	0.733	multicellular organismal process
GO:0006357	0.697	regulation of transcription by RNA polymerase II
GO:0032502	0.668	developmental process
GO:0071704	0.599	organic substance metabolic process
GO:0071840	0.557	cellular component organization or biogenesis
GO:0016043	0.543	cellular component organization
GO:0045944	0.516	positive regulation of transcription by RNA polymerase II
GO:0048856	0.458	anatomical structure development
GO:0044237	0.451	cellular metabolic process
GO:0048519	0.364	negative regulation of biological process
GO:0006807	0.300	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.965	cytoplasm
GO:0016020	0.924	membrane
GO:0001673	0.338	male germ cell nucleus
GO:0032991	0.314	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]