StarFunc result for job id Q9Y4C2

User Input

>input (921 residues)
MATPSAAFEALMNGVTSWDVPEDAVPCELLLIGEASFPVMVNDMGQVLIAASSYGRGRLV
VVSHEDYLVEAQLTPFLLNAVGWLCSSPGAPIGVHPSLAPLAKILEGSGVDAKVEPEVKD
SLGVYCIDAYNETMTEKLVKFMKCGGGLLIGGQAWDWANQGEDERVLFTFPGNLVTSVAG
IYFTDNKGDTSFFKVSKKMPKIPVLVSCEDDLSDDREELLHGISELDISNSDCFPSQLLV
HGALAFPLGLDSYHGCVIAAARYGRGRVVVTGHKVLFTVGKLGPFLLNAVRWLDGGRRGK
VVVQTELRTLSGLLAVGGIDTSIEPNLTSDASVYCFEPVSEVGVKELQEFVAEGGGLFVG
AQAWWWAFKNPGVSPLARFPGNLLLNPFGISITSQSLNPGPFRTPKAGIRTYHFRSTLAE
FQVIMGRKRGNVEKGWLAKLGPDGAAFLQIPAEEIPAYMSVHRLLRKLLSRYRLPVATRE
NPVINDCCRGAMLSLATGLAHSGSDLSLLVPEIEDMYSSPYLRPSESPITVEVNCTNPGT
RYCWMSTGLYIPGRQIIEVSLPEAAASADLKIQIGCHTDDLTRASKLFRGPLVINRCCLD
KPTKSITCLWGGLLYIIVPQNSKLGSVPVTVKGAVHAPYYKLGETTLEEWKRRIQENPGP
WGELATDNIILTVPTANLRTLENPEPLLRLWDEVMQAVARLGAEPFPLRLPQRIVADVQI
SVGWMHAGYPIMCHLESVQELINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCN
LWCVYVHETVLGIPRSRANIALWPPVREKRVRIYLSKGPNVKNWNAWTALETYLQLQEAF
GWEPFIRLFTEYRNQTNLPTENVDKMNLWVKMFSHQVQKNLAPFFEAWAWPIQKEVATSL
AYLPEWKENIMKLYLLTQMPH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NFQ2	0.909	0.911	0.000	919	0.643	0.644	A6NFQ2.pdb.gz	TCAF2_HUMAN TRPM8 channel-associated factor 2 OS=Homo sapiens OX=9606 GN=TCAF2 PE=1 SV=2
2	AFDB:Q6QR59	0.847	0.852	0.000	914	0.508	0.512	Q6QR59.pdb.gz	TCAF3_MOUSE TRPM8 channel-associated factor 3 OS=Mus musculus OX=10090 GN=Tcaf3 PE=1 SV=1
3	AFDB:Q921K8	0.953	0.955	0.000	919	0.617	0.618	Q921K8.pdb.gz	TCAF2_MOUSE TRPM8 channel-associated factor 2 OS=Mus musculus OX=10090 GN=Tcaf2 PE=1 SV=1
4	AFDB:Q9Y4C2	1.000	1.000	0.000	921	1.000	1.000	Q9Y4C2.pdb.gz	TCAF1_HUMAN TRPM8 channel-associated factor 1 OS=Homo sapiens OX=9606 GN=TCAF1 PE=1 SV=3
5	PDB:5kdvA	0.386	0.397	1.231E-23	891	0.134	0.138	5kdvA.pdb.gz	Recognition of protein-linked glycans as a determinant of peptidase activity.
6	AFDB:Q9I5W4	0.410	0.409	8.749E-23	923	0.135	0.134	Q9I5W4.pdb.gz	IMPA_PSEAE Immunomodulating metalloprotease OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=impA PE=1 SV=1
7	PDB:6rqxA	0.143	0.151	1.103E-4	862	0.052	0.056	6rqxA.pdb.gz	Mechanism for antigenic peptide selection by endoplasmic reticulum aminopeptidase 1.
8	AFDB:Q9EQH2	0.148	0.147	4.926E-4	930	0.059	0.058	Q9EQH2.pdb.gz	ERAP1_MOUSE Endoplasmic reticulum aminopeptidase 1 OS=Mus musculus OX=10090 GN=Erap1 PE=1 SV=2
9	AFDB:Q9VTL4	0.156	0.151	5.461E-4	962	0.064	0.061	Q9VTL4.pdb.gz	Q9VTL4_DROME Aminopeptidase N OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6071 PE=3 SV=2
10	AFDB:Q22317	0.173	0.163	7.836E-4	988	0.059	0.055	Q22317.pdb.gz	Q22317_CAEEL Aminopeptidase OS=Caenorhabditis elegans OX=6239 GN=anp-1 PE=1 SV=2
11	PDB:3mdjC	0.168	0.185	8.681E-4	819	0.047	0.053	3mdjC.pdb.gz	Structural basis for antigenic peptide precursor processing by the endoplasmic reticulum aminopeptidase ERAP1.
12	PDB:7z8bC	0.078	0.068	1.612E-3	1224	0.088	0.066	7z8bC.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
13	PDB:4wz9B	0.183	0.189	2.700E-3	887	0.043	0.045	4wz9B.pdb.gz	The Anopheles-midgut APN1 structure reveals a new malaria transmission-blocking vaccine epitope.
14	AFDB:Q7Q2T8	0.178	0.163	2.702E-3	1020	0.046	0.041	Q7Q2T8.pdb.gz	AMPN_ANOGA Aminopeptidase N OS=Anopheles gambiae OX=7165 GN=APN1 PE=1 SV=4
15	AFDB:Q7KRW4	0.177	0.165	3.683E-3	999	0.042	0.039	Q7KRW4.pdb.gz	Q7KRW4_DROME Aminopeptidase OS=Drosophila melanogaster OX=7227 GN=superdeath PE=1 SV=1
16	PDB:4o0mA	0.088	0.149	3.875E-3	494	0.051	0.095	4o0mA.pdb.gz	An arginine tetrad as mediator of input-dependent and input-independent ATPases in the clock protein KaiC
17	PDB:7nupD	0.162	0.168	4.080E-3	884	0.055	0.058	7nupD.pdb.gz	Endoplasmic reticulum aminopeptidase 2 complexed with a mixed hydroxamic and sulfonyl ligand
18	PDB:5k1vB	0.162	0.174	5.015E-3	849	0.054	0.059	5k1vB.pdb.gz	Crystal Structures of ERAP2 Complexed with Inhibitors Reveal Pharmacophore Requirements for Optimizing Inhibitor Potency.
19	PDB:4kx7A	0.160	0.167	5.560E-3	875	0.052	0.055	4kx7A.pdb.gz	Structural insights into central hypertension regulation by human aminopeptidase a.
20	PDB:4uybA	0.072	0.134	7.577E-3	401	0.052	0.120	4uybA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GVM2	0.0	936	712	0.489	0.632	A0A1B0GVM2_HUMAN TRPM8 channel associated factor 2C (Fragment) OS=Homo sapiens OX=9606 GN=TCAF2C PE=4 SV=1
2	A6NFQ2	0.0	1213	919	0.638	0.640	TCAF2_HUMAN TRPM8 channel-associated factor 2 OS=Homo sapiens OX=9606 GN=TCAF2 PE=1 SV=2
3	Q6QR59	0.0	944	914	0.506	0.510	TCAF3_MOUSE TRPM8 channel-associated factor 3 OS=Mus musculus OX=10090 GN=Tcaf3 PE=1 SV=1
4	Q8N1I1	0.0	739	564	0.385	0.629	Q8N1I1_HUMAN TRPM8 channel associated factor 2 OS=Homo sapiens OX=9606 GN=TCAF2 PE=1 SV=1
5	Q921K8	0.0	1169	919	0.615	0.616	TCAF2_MOUSE TRPM8 channel-associated factor 2 OS=Mus musculus OX=10090 GN=Tcaf2 PE=1 SV=1
6	Q9Y4C2	0.0	1894	921	1.000	1.000	TCAF1_HUMAN TRPM8 channel-associated factor 1 OS=Homo sapiens OX=9606 GN=TCAF1 PE=1 SV=3
7	O89110	3.9	33.5	480	0.026	0.050	CASP8_MOUSE Caspase-8 OS=Mus musculus OX=10090 GN=Casp8 PE=1 SV=1
8	O82122	4.0	33.1	265	0.043	0.151	VSP2_ARATH Vegetative storage protein 2 OS=Arabidopsis thaliana OX=3702 GN=VSP2 PE=2 SV=1
9	A8WG75	4.5	33.5	528	0.021	0.036	A8WG75_DANRE Pdia5 protein OS=Danio rerio OX=7955 GN=zgc:172235 PE=1 SV=1
10	A2BGM5	7.4	32.7	550	0.024	0.040	FOXN4_DANRE Forkhead box protein N4 OS=Danio rerio OX=7955 GN=foxn4 PE=1 SV=1
11	D4AEC2	7.4	32.7	1470	0.027	0.017	CAMP2_RAT Calmodulin-regulated spectrin-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Camsap2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17291 M60-like_N	9.8e-25	98.0	N-terminal domain of M60-like peptidases
2	PF13402 Peptidase_M60	3.8e-76	267.7	Peptidase M60, enhancin and enhancin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419235

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000474388	0.632	CTAGE family member 6
2	9606.ENSP00000323926	0.593	Transient receptor potential cation channel subfamily M member 8
3	9606.ENSP00000387081	0.563	Uncharacterized LOC150527
4	9606.ENSP00000387307	0.503	Ras-related protein Rab-6C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044325	1.000	transmembrane transporter binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0032879	0.989	regulation of localization
GO:0065009	0.958	regulation of molecular function
GO:0032880	0.928	regulation of protein localization
GO:0048518	0.887	positive regulation of biological process
GO:0048523	0.882	negative regulation of cellular process
GO:1903829	0.877	positive regulation of protein localization
GO:0009987	0.862	cellular process
GO:0044093	0.853	positive regulation of molecular function
GO:0051049	0.852	regulation of transport
GO:0051050	0.832	positive regulation of transport
GO:0032386	0.822	regulation of intracellular transport
GO:1903533	0.814	regulation of protein targeting
GO:0034762	0.719	regulation of transmembrane transport
GO:1905477	0.714	positive regulation of protein localization to membrane
GO:0032412	0.675	regulation of monoatomic ion transmembrane transporter activity
GO:0034765	0.667	regulation of monoatomic ion transmembrane transport
GO:0051222	0.656	positive regulation of protein transport
GO:0090316	0.582	positive regulation of intracellular protein transport
GO:0030334	0.561	regulation of cell migration
GO:0032414	0.334	positive regulation of ion transmembrane transporter activity
GO:0040013	0.323	negative regulation of locomotion
GO:2000146	0.309	negative regulation of cell motility

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005622	0.493	intracellular anatomical structure
GO:0043227	0.492	membrane-bounded organelle
GO:0043231	0.468	intracellular membrane-bounded organelle
GO:0005737	0.446	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]