StarFunc result for job id Q9Y4C4

User Input

>input (1052 residues)
MAGMDSGNLKTARLWRDAALRARKLRSNLRQLTLTAAGACPGAGADALESPASPQLVLPA
NLGDIEALNLGNNGLEEVPEGLGSALGSLRVLVLRRNRFARLPPAVAELGHHLTELDVSH
NRLTALGAEVVSALRELRKLNLSHNQLPALPAQLGALAHLEELDVSFNRLAHLPDSLSCL
SRLRTLDVDHNQLTAFPRQLLQLVALEELDVSSNRLRGLPEDISALRALKILWLSGAELG
TLPAGFCELASLESLMLDNNGLQALPAQFSCLQRLKMLNLSSNLFEEFPAALLPLAGLEE
LYLSRNQLTSVPSLISGLGRLLTLWLDNNRIRYLPDSIVELTGLEELVLQGNQIAVLPDH
FGQLSRVGLWKIKDNPLIQPPYEVCMKGIPYIAAYQKELAHSQPAVQPRLKLLLMGHKAA
GKTLLRHCLTEERVEGCPGGGDKEKCYPPSPPPVSKGIEVTSWTADASRGLRFIVYDLAG
DESYEVIQPFFLSPGALYVLVVNLATYEPRHFPTTVGSFLHRVGARVPHAVVCIVGTHAD
LCGERELEEKCLDIHRQIALQEKHDAEGLSRLAKVVDEALARDFELRSASPHAAYYGVSD
KNLRRRKAHFQYLLNHRLQILSPVLPVSCRDPRHLRRLRDKLLSVAEHREIFPNLHRVLP
RSWQVLEELHFQPPQAQRLWLSWWDSARLGLQAGLTEDRLQSALSYLHESGKLLYFEDSP
ALKEHVFHNLTRLIDILNVFFQRDPSLLLHKLLLGTSGEGKAEGESSPPMARSTPSQELL
RATQLHQYVEGFLLHGLLPAHVIRLLLKPHVQAQQDLQLLLELLEKMGLCYCLNKPKGKP
LNGSTAWYKFPCYVQNEVPHAEAWINGTNLAGQSFVAEQLQIEYSFPFTFPLGLFARYSV
QINSHVVHRSDGKFQIFAYRGKVPVVVSYRPARGVLQPDTLSIASHASLPNIWTAWQAIT
PLVEELNVLLQEWPGLHYTVHILCSKCLKRGSPNPHAFPGELLSQPRPEGVAEIICPKNG
SERVNVALVYPPTPTVISPCSKKNVGEKHRNQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y4C4	1.000	1.000	0.000	1052	1.000	1.000	Q9Y4C4.pdb.gz	MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens OX=9606 GN=MFHAS1 PE=1 SV=2
2	AFDB:Q38SD2	0.372	0.210	1.927E-36	2015	0.217	0.113	Q38SD2.pdb.gz	LRRK1_HUMAN Leucine-rich repeat serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=LRRK1 PE=1 SV=3
3	AFDB:Q8KC98	0.490	0.472	1.065E-34	1102	0.183	0.175	Q8KC98.pdb.gz	Q8KC98_CHLTE Rab family protein OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=CT1526 PE=1 SV=1
4	AFDB:Q3UHC2	0.377	0.213	6.467E-34	2014	0.211	0.110	Q3UHC2.pdb.gz	LRRK1_MOUSE Leucine-rich repeat serine/threonine-protein kinase 1 OS=Mus musculus OX=10090 GN=Lrrk1 PE=1 SV=1
5	AFDB:Q5S006	0.443	0.217	6.446E-33	2527	0.180	0.075	Q5S006.pdb.gz	LRRK2_MOUSE Leucine-rich repeat serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Lrrk2 PE=1 SV=2
6	AFDB:Q5S007	0.470	0.228	3.576E-32	2527	0.183	0.076	Q5S007.pdb.gz	LRRK2_HUMAN Leucine-rich repeat serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=LRRK2 PE=1 SV=2
7	AFDB:A0A0B4KHT3	0.366	0.173	1.971E-29	2513	0.186	0.078	A0A0B4KHT3.pdb.gz	A0A0B4KHT3_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Lrrk PE=4 SV=1
8	AFDB:Q8MVR1	0.398	0.181	6.363E-29	2631	0.141	0.056	Q8MVR1.pdb.gz	GBPC_DICDI Cyclic GMP-binding protein C OS=Dictyostelium discoideum OX=44689 GN=gbpC PE=1 SV=1
9	AFDB:Q54WS5	0.371	0.208	7.972E-29	2147	0.191	0.094	Q54WS5.pdb.gz	ROCO6_DICDI Probable serine/threonine-protein kinase roco6 OS=Dictyostelium discoideum OX=44689 GN=roco6 PE=3 SV=1
10	AFDB:Q9TZM3	0.333	0.165	1.958E-27	2393	0.187	0.082	Q9TZM3.pdb.gz	LRK1_CAEEL Leucine-rich repeat serine/threonine-protein kinase 1 OS=Caenorhabditis elegans OX=6239 GN=lrk-1 PE=1 SV=6
11	PDB:7lhwA	0.552	0.340	1.930E-23	1813	0.168	0.098	7lhwA.pdb.gz	Structural analysis of the full-length human LRRK2.
12	PDB:7tvfD	0.223	0.374	1.102E-17	515	0.123	0.250	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
13	PDB:7p5vB	0.241	0.333	3.347E-12	732	0.087	0.126	7p5vB.pdb.gz
14	PDB:6xr4A	0.313	0.317	2.223E-11	1040	0.094	0.095	6xr4A.pdb.gz
15	PDB:6hkwA	0.221	0.726	8.570E-10	306	0.062	0.212	6hkwA.pdb.gz
16	PDB:7lt9A	0.169	0.651	1.229E-9	251	0.065	0.271	7lt9A.pdb.gz	Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly.
17	PDB:5xjxC	0.206	0.530	2.767E-9	365	0.078	0.225	5xjxC.pdb.gz
18	PDB:6gffI	0.237	0.415	8.937E-9	551	0.102	0.194	6gffI.pdb.gz
19	PDB:7wv3A	0.189	0.263	1.535E-8	668	0.086	0.135	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
20	PDB:3t6qA	0.236	0.386	1.116E-7	601	0.076	0.133	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3V1N1	0.0	1913	1048	0.944	0.948	MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus OX=10090 GN=Mfhas1 PE=1 SV=2
2	Q9Y4C4	0.0	2128	1052	1.000	1.000	MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens OX=9606 GN=MFHAS1 PE=1 SV=2
3	Q55E58	1.48e-45	182	3184	0.178	0.059	PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum OX=44689 GN=pats1 PE=3 SV=1
4	Q6Z8P4	8.66e-40	158	576	0.097	0.177	PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica OX=39947 GN=IRL4 PE=2 SV=1
5	Q8S7M7	2.57e-38	153	543	0.098	0.190	PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica OX=39947 GN=IRL5 PE=2 SV=1
6	Q9SVW8	9.29e-37	149	549	0.092	0.177	PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana OX=3702 GN=PIRL4 PE=1 SV=1
7	Q5G5E0	5.69e-36	146	526	0.099	0.198	PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana OX=3702 GN=PIRL5 PE=2 SV=1
8	Q96RT1	2.75e-35	148	1412	0.095	0.071	ERBIN_HUMAN Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2
9	A0A8I6ACI5	8.73e-35	147	1364	0.095	0.073	A0A8I6ACI5_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
10	A0A8I5ZN42	9.22e-35	146	1230	0.095	0.081	A0A8I5ZN42_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
11	A0A8I5ZWX2	9.82e-35	146	1403	0.095	0.071	A0A8I5ZWX2_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
12	A0A8I6AE43	1.03e-34	146	1451	0.095	0.069	A0A8I6AE43_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
13	Q80TH2	1.03e-34	146	1402	0.095	0.071	ERBIN_MOUSE Erbin OS=Mus musculus OX=10090 GN=Erbin PE=1 SV=3
14	A0A8I6A8N1	1.06e-34	146	1295	0.095	0.077	A0A8I6A8N1_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
15	Q1ZXD6	2.96e-34	145	2800	0.151	0.057	ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum OX=44689 GN=roco5 PE=3 SV=1
16	Q9VEK6	5.13e-34	142	641	0.107	0.176	SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster OX=7227 GN=Sur-8 PE=2 SV=3
17	Q7KRY7	2.26e-33	142	1851	0.099	0.056	SCRIB_DROME Protein lap4 OS=Drosophila melanogaster OX=7227 GN=scrib PE=1 SV=1
18	Q9BTT6	3.30e-33	137	524	0.097	0.195	LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=LRRC1 PE=1 SV=1
19	P70587	4.42e-32	138	1490	0.092	0.065	LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Lrrc7 PE=1 SV=2
20	Q96NW7	7.73e-32	137	1537	0.091	0.062	LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=LRRC7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16095 COR	2.7e-08	45.4	C-terminal of Roc, COR, domain
2	PF00560 LRR_1	1.3e-07	41.9	Leucine Rich Repeat
3	PF12799 LRR_4	9.9e-30	113.3	Leucine Rich repeats (2 copies)
4	PF13516 LRR_6	6e-05	33.8	Leucine Rich repeat
5	PF13855 LRR_8	9.4e-45	161.5	Leucine rich repeat
6	PF14580 LRR_9	6.7e-05	34.0	Leucine-rich repeat
7	PF00071 Ras	5.1	18.2	Ras family
8	PF08477 Roc	0.00053	31.6	Ras of Complex, Roc, domain of DAPkinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000276282

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000428780	0.921	Claudin-23
2	9606.ENSP00000308318	0.903	Protein phosphatase 1 regulatory subunit 3B
3	9606.ENSP00000282026	0.691	ADP-ribosylation factor-like protein 11
4	9606.ENSP00000354775	0.573	E3 ubiquitin-protein ligase Praja-2
5	9606.ENSP00000392025	0.563	Ubiquitin carboxyl-terminal hydrolase CYLD
6	9606.ENSP00000380185	0.559	Pleckstrin homology domain-containing family G member 6
7	9606.ENSP00000386135	0.550	Death-associated protein kinase 1
8	9606.ENSP00000297440	0.541	Dynein assembly factor 5, axonemal

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019903	1.000	protein phosphatase binding
GO:0005525	0.995	GTP binding
GO:0051721	0.994	protein phosphatase 2A binding
GO:0044389	0.968	ubiquitin-like protein ligase binding
GO:0031625	0.863	ubiquitin protein ligase binding
GO:0003824	0.343	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.996	response to stimulus
GO:0002831	0.992	regulation of response to biotic stimulus
GO:0031347	0.992	regulation of defense response
GO:0050776	0.991	regulation of immune response
GO:0032101	0.990	regulation of response to external stimulus
GO:0009987	0.987	cellular process
GO:0048519	0.987	negative regulation of biological process
GO:0048584	0.986	positive regulation of response to stimulus
GO:0009966	0.986	regulation of signal transduction
GO:0045088	0.979	regulation of innate immune response
GO:0006950	0.974	response to stress
GO:0002683	0.972	negative regulation of immune system process
GO:0045089	0.968	positive regulation of innate immune response
GO:0043207	0.966	response to external biotic stimulus
GO:0009967	0.966	positive regulation of signal transduction
GO:0023057	0.964	negative regulation of signaling
GO:0048585	0.963	negative regulation of response to stimulus
GO:0048523	0.963	negative regulation of cellular process
GO:0044419	0.961	biological process involved in interspecies interaction between organisms
GO:0006952	0.956	defense response
GO:0062207	0.956	regulation of pattern recognition receptor signaling pathway
GO:0009968	0.952	negative regulation of signal transduction
GO:0062208	0.949	positive regulation of pattern recognition receptor signaling pathway
GO:0002376	0.911	immune system process
GO:0051707	0.897	response to other organism
GO:0006955	0.876	immune response
GO:0006954	0.867	inflammatory response
GO:0045087	0.840	innate immune response
GO:1902531	0.690	regulation of intracellular signal transduction
GO:0019222	0.538	regulation of metabolic process
GO:0060255	0.521	regulation of macromolecule metabolic process
GO:0031323	0.502	regulation of cellular metabolic process
GO:0080090	0.498	regulation of primary metabolic process
GO:0051171	0.358	regulation of nitrogen compound metabolic process
GO:0071704	0.340	organic substance metabolic process
GO:0051716	0.334	cellular response to stimulus
GO:0032502	0.332	developmental process
GO:0048856	0.318	anatomical structure development
GO:0032501	0.311	multicellular organismal process
GO:0044237	0.306	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043226	0.972	organelle
GO:0043229	0.958	intracellular organelle
GO:0043231	0.863	intracellular membrane-bounded organelle
GO:0005829	0.797	cytosol
GO:0005634	0.426	nucleus
GO:0005886	0.340	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]