StarFunc result for job id Q9Y4D1

User Input

>input (1078 residues)
MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSEL
VDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQLNSMAARKSLL
ALEKEEEEERSKTIESLKTALRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTS
LIGCIKALMNNSQGRAHVLAHSESINVIAQSLSTENIKTKVAVLEILGAVCLVPGGHKKV
LQAMLHYQKYASERTRFQTLINDLDKSTGRYRDEVSLKTAIMSFINAVLSQGAGVESLDF
RLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFELVHIDTKSA
TQMFELTRKRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKGQ
DPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEK
EEMMQTLNKMKEKLEKETTEHKQVKQQVADLTAQLHELSRRAVCASIPGGPSPGAPGGPF
PSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAPMGLALKK
KSIPQPTNALKSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSAYQRQQDFFV
NSNSKQKEADAIDDTLSSKLKVKELSVIDGRRAQNCNILLSRLKLSNDEIKRAILTMDEQ
EDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHYQQRLQSLYFK
KKFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNYMNKGQRGNAYGFKISSL
NKIADTKSSIDKNITLLHYLITIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLR
SGLKAVETELEYQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKDLFTKAVKHF
GEEAGKIQPDEFFGIFDQFLQAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKM
RKAKENSEESGEFDDLVSALRSGEVFDKDLSKLKRNRKRITNQMTDSSRERPITKLNF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IER9	0.780	0.792	0.000	1060	0.801	0.815	A0A0R4IER9.pdb.gz	A0A0R4IER9_DANRE Disheveled-associated activator of morphogenesis 1 isoform X2 OS=Danio rerio OX=7955 GN=daam1a PE=4 SV=1
2	AFDB:Q5RHJ3	0.503	0.503	0.000	1079	0.822	0.821	Q5RHJ3.pdb.gz	Q5RHJ3_DANRE Disheveled-associated activator of morphogenesis 1 OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
3	AFDB:Q9Y4D1	1.000	1.000	0.000	1078	1.000	1.000	Q9Y4D1.pdb.gz	DAAM1_HUMAN Disheveled-associated activator of morphogenesis 1 OS=Homo sapiens OX=9606 GN=DAAM1 PE=1 SV=2
4	AFDB:A0A1D5P556	0.711	0.713	2.001E-100	1075	0.706	0.708	A0A1D5P556.pdb.gz	DAAM2_CHICK Disheveled-associated activator of morphogenesis 2 OS=Gallus gallus OX=9031 GN=DAAM2 PE=1 SV=2
5	AFDB:Q86T65	0.475	0.479	1.991E-99	1068	0.681	0.687	Q86T65.pdb.gz	DAAM2_HUMAN Disheveled-associated activator of morphogenesis 2 OS=Homo sapiens OX=9606 GN=DAAM2 PE=1 SV=3
6	AFDB:Q80U19	0.508	0.492	1.760E-91	1115	0.671	0.648	Q80U19.pdb.gz	DAAM2_MOUSE Disheveled-associated activator of morphogenesis 2 OS=Mus musculus OX=10090 GN=Daam2 PE=1 SV=4
7	AFDB:M9MSM5	0.561	0.432	1.362E-73	1463	0.494	0.364	M9MSM5.pdb.gz	M9MSM5_DROME Dishevelled associated activator of morphogenesis, isoform D OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1
8	AFDB:Q9W5A4	0.384	0.419	2.470E-64	979	0.422	0.465	Q9W5A4.pdb.gz	Q9W5A4_DROME EG:114D9.2 protein OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=2
9	AFDB:O60610	0.444	0.387	6.754E-43	1272	0.296	0.251	O60610.pdb.gz	DIAP1_HUMAN Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1 PE=1 SV=2
10	AFDB:Q9NSV4	0.509	0.468	8.594E-40	1193	0.268	0.242	Q9NSV4.pdb.gz	DIAP3_HUMAN Protein diaphanous homolog 3 OS=Homo sapiens OX=9606 GN=DIAPH3 PE=1 SV=4
11	PDB:3zhpA	0.149	0.410	6.310E-2	315	0.034	0.117	3zhpA.pdb.gz
12	PDB:4ct7B	0.176	0.616	1.051E-1	269	0.033	0.134	4ct7B.pdb.gz	Structural and Biochemical Insights to the Role of the Ccr4-not Complex and Ddx6 ATPase in Microrna Repression.
13	PDB:3tpoA	0.166	0.367	1.145E-1	438	0.032	0.078	3tpoA.pdb.gz
14	PDB:5voxP	0.148	0.295	1.357E-1	462	0.041	0.095	5voxP.pdb.gz
15	PDB:7a9wA	0.070	0.114	1.991E-1	513	0.049	0.103	7a9wA.pdb.gz	The pentatricopeptide repeat protein Rmd9 recognizes the dodecameric element in the 3'-UTRs of yeast mitochondrial mRNAs.
16	PDB:4hm9A	0.161	0.306	2.262E-1	511	0.058	0.121	4hm9A.pdb.gz
17	PDB:4tnmA	0.150	0.340	2.262E-1	407	0.057	0.150	4tnmA.pdb.gz
18	PDB:2z6gA	0.088	0.136	2.570E-1	550	0.048	0.095	2z6gA.pdb.gz
19	PDB:7dkhI	0.106	0.118	2.681E-1	914	0.095	0.112	7dkhI.pdb.gz
20	PDB:7r03B	0.090	0.053	2.920E-1	2246	0.064	0.031	7r03B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IER9	0.0	969	1060	0.414	0.421	A0A0R4IER9_DANRE Disheveled-associated activator of morphogenesis 1 isoform X2 OS=Danio rerio OX=7955 GN=daam1a PE=4 SV=1
2	A0A1D5P556	0.0	807	1075	0.352	0.353	DAAM2_CHICK Disheveled-associated activator of morphogenesis 2 OS=Gallus gallus OX=9031 GN=DAAM2 PE=1 SV=2
3	B3DJI0	0.0	958	1069	0.419	0.423	B3DJI0_DANRE Daam1l protein OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
4	M9MSM5	0.0	926	1463	0.497	0.366	M9MSM5_DROME Dishevelled associated activator of morphogenesis, isoform D OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1
5	Q5BII2	0.0	847	1011	0.445	0.475	Q5BII2_DROME RE67944p OS=Drosophila melanogaster OX=7227 GN=DAAM PE=2 SV=1
6	Q5RHJ3	0.0	959	1079	0.419	0.419	Q5RHJ3_DANRE Disheveled-associated activator of morphogenesis 1 OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
7	Q7YZA4	0.0	904	1114	0.481	0.466	Q7YZA4_DROME Dishevelled associated activator of morphogenesis, isoform A OS=Drosophila melanogaster OX=7227 GN=DAAM PE=1 SV=1
8	Q80U19	0.0	766	1115	0.340	0.328	DAAM2_MOUSE Disheveled-associated activator of morphogenesis 2 OS=Mus musculus OX=10090 GN=Daam2 PE=1 SV=4
9	Q86T65	0.0	782	1068	0.344	0.347	DAAM2_HUMAN Disheveled-associated activator of morphogenesis 2 OS=Homo sapiens OX=9606 GN=DAAM2 PE=1 SV=3
10	Q8BPM0	0.0	2163	1077	0.971	0.972	DAAM1_MOUSE Disheveled-associated activator of morphogenesis 1 OS=Mus musculus OX=10090 GN=Daam1 PE=1 SV=4
11	Q8IRY0	0.0	927	1153	0.494	0.462	Q8IRY0_DROME Dishevelled associated activator of morphogenesis, isoform B OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1
12	Q8MT16	0.0	897	1114	0.480	0.464	Q8MT16_DROME RH61354p OS=Drosophila melanogaster OX=7227 GN=DAAM PE=2 SV=1
13	Q9W5A4	0.0	796	979	0.417	0.459	Q9W5A4_DROME EG:114D9.2 protein OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=2
14	Q9Y4D1	0.0	2225	1078	1.000	1.000	DAAM1_HUMAN Disheveled-associated activator of morphogenesis 1 OS=Homo sapiens OX=9606 GN=DAAM1 PE=1 SV=2
15	G3V275	3.47e-59	199	96	0.084	0.948	G3V275_HUMAN Dishevelled associated activator of morphogenesis 1 OS=Homo sapiens OX=9606 GN=DAAM1 PE=1 SV=1
16	Q6ZPF4	3.16e-56	214	1028	0.131	0.137	FMNL3_MOUSE Formin-like protein 3 OS=Mus musculus OX=10090 GN=Fmnl3 PE=1 SV=2
17	Q8IVF7	4.56e-56	214	1028	0.131	0.137	FMNL3_HUMAN Formin-like protein 3 OS=Homo sapiens OX=9606 GN=FMNL3 PE=1 SV=3
18	Q6NXC0	1.85e-55	212	1047	0.138	0.142	FMNL3_DANRE Formin-like protein 3 OS=Danio rerio OX=7955 GN=fmnl3 PE=2 SV=2
19	F8W1F5	6.13e-55	210	1027	0.131	0.137	F8W1F5_HUMAN Formin like 3 OS=Homo sapiens OX=9606 GN=FMNL3 PE=1 SV=1
20	O60879	1.88e-52	202	1101	0.137	0.134	DIAP2_HUMAN Protein diaphanous homolog 2 OS=Homo sapiens OX=9606 GN=DIAPH2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06367 Drf_FH3	5.6e-57	204.1	Diaphanous FH3 Domain
2	PF06371 Drf_GBD	3.6e-51	185.0	Diaphanous GTPase-binding Domain
3	PF02181 FH2	3.1e-111	383.8	Formin Homology 2 Domain
4	PF05308 Mito_fiss_reg	14	17.3	Mitochondrial fission regulator
5	PF07926 TPR_MLP1_2	7.5e+02	11.6	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378557

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368169	0.999	Segment polarity protein dishevelled homolog DVL-1
2	9606.ENSP00000400175	0.999	Transforming protein RhoA
3	9606.ENSP00000005340	0.997	Segment polarity protein dishevelled homolog DVL-2
4	9606.ENSP00000316054	0.981	Segment polarity protein dishevelled homolog DVL-3
5	9606.ENSP00000225655	0.921	Profilin-1
6	9606.ENSP00000270747	0.913	Rho guanine nucleotide exchange factor 19
7	9606.ENSP00000267260	0.907	Serine/arginine repetitive matrix protein 4
8	9606.ENSP00000381876	0.881	Dishevelled associated activator of morphogenesis 2
9	9606.ENSP00000264634	0.864	Protein Wnt-5a
10	9606.ENSP00000325526	0.858	Protein Wnt-11
11	9606.ENSP00000383118	0.837	Cell division control protein 42 homolog
12	9606.ENSP00000285735	0.828	Rho-related GTP-binding protein RhoC
13	9606.ENSP00000437489	0.823	Frizzled-3
14	9606.ENSP00000308576	0.817	Rho-related GTP-binding protein RhoD
15	9606.ENSP00000357177	0.813	Rho guanine nucleotide exchange factor 11
16	9606.ENSP00000286201	0.809	Frizzled-7
17	9606.ENSP00000380379	0.804	Protein Wnt-5b
18	9606.ENSP00000351605	0.802	Frizzled-6
19	9606.ENSP00000293549	0.789	Proto-oncogene Wnt-1
20	9606.ENSP00000290167	0.787	Protein Wnt-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.677	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.950	multicellular organismal process
GO:0032502	0.947	developmental process
GO:0050789	0.932	regulation of biological process
GO:0048856	0.929	anatomical structure development
GO:0050794	0.913	regulation of cellular process
GO:0007275	0.905	multicellular organism development
GO:0048731	0.845	system development
GO:0009987	0.816	cellular process
GO:0009653	0.798	anatomical structure morphogenesis
GO:0007399	0.695	nervous system development
GO:0060429	0.607	epithelium development
GO:0016043	0.571	cellular component organization
GO:0007417	0.548	central nervous system development
GO:0048513	0.531	animal organ development
GO:0060026	0.517	convergent extension
GO:0048518	0.501	positive regulation of biological process
GO:0048522	0.484	positive regulation of cellular process
GO:0007420	0.426	brain development
GO:0006996	0.411	organelle organization
GO:0050896	0.310	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015629	1.000	actin cytoskeleton
GO:0005737	0.998	cytoplasm
GO:0005886	0.992	plasma membrane
GO:0005829	0.986	cytosol
GO:0043227	0.985	membrane-bounded organelle
GO:0032432	0.981	actin filament bundle
GO:0042641	0.961	actomyosin
GO:0097517	0.928	contractile actin filament bundle
GO:0031982	0.911	vesicle
GO:0001725	0.900	stress fiber
GO:0005576	0.717	extracellular region
GO:0043231	0.716	intracellular membrane-bounded organelle
GO:0120025	0.702	plasma membrane bounded cell projection
GO:0070062	0.687	extracellular exosome
GO:0015630	0.435	microtubule cytoskeleton
GO:0005815	0.433	microtubule organizing center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]