StarFunc result for job id Q9Y4D2

User Input

>input (1042 residues)
MPGIVVFRRRWSVGSDDLVLPAIFLFLLHTTWFVILSVVLFGLVYNPHEACSLNLVDHGR
GYLGILLSCMIAEMAIIWLSMRGGILYTEPRDSMQYVLYVRLAILVIEFIYAIVGIVWLT
QYYTSCNDLTAKNVTLGMVVCNWVVILSVCITVLCVFDPTGRTFVKLRATKRRQRNLRTY
NLRHRLEEGQATSWSRRLKVFLCCTRTKDSQSDAYSEIAYLFAEFFRDLDIVPSDIIAGL
VLLRQRQRAKRNAVLDEANNDILAFLSGMPVTRNTKYLDLKNSQEMLRYKEVCYYMLFAL
AAYGWPMYLMRKPACGLCQLARSCSCCLCPARPRFAPGVTIEEDNCCGCNAIAIRRHFLD
ENMTAVDIVYTSCHDAVYETPFYVAVDHDKKKVVISIRGTLSPKDALTDLTGDAERLPVE
GHHGTWLGHKGMVLSAEYIKKKLEQEMVLSQAFGRDLGRGTKHYGLIVVGHSLGAGTAAI
LSFLLRPQYPTLKCFAYSPPGGLLSEDAMEYSKEFVTAVVLGKDLVPRIGLSQLEGFRRQ
LLDVLQRSTKPKWRIIVGATKCIPKSELPEEVEVTTLASTRLWTHPSDLTIALSASTPLY
PPGRIIHVVHNHPAEQCCCCEQEEPTYFAIWGDNKAFNEVIISPAMLHEHLPYVVMEGLN
KVLENYNKGKTALLSAAKVMVSPTEVDLTPELIFQQQPLPTGPPMPTGLALELPTADHRN
SSVRSKSQSEMSLEGFSEGRLLSPVVAAAARQDPVELLLLSTQERLAAELQARRAPLATM
ESLSDTESLYSFDSRRSSGFRSIRGSPSLHAVLERDEGHLFYIDPAIPEENPSLSSRTEL
LAADSLSKHSQDTQPLEAALGSGGVTPERPPSAAANDEEEEVGGGGGGPASRGELALHNG
RLGDSPSPQVLEFAEFIDSLFNLDSKSSSFQDLYCMVVPESPTSDYAEGPKSPSQQEILL
RAQFEPNLVPKPPRLFAGSADPSSGISLSPSFPLSSSGELMDLTPTGLSSQECLAADKIR
TSTPTGHGASPAKQDELVISAR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H0Z867	0.639	0.646	0.000	1031	0.881	0.890	H0Z867.pdb.gz	H0Z867_TAEGU sn-1-specific diacylglycerol lipase OS=Taeniopygia guttata OX=59729 GN=DAGLA PE=4 SV=2
2	AFDB:H0Z871	0.577	0.594	0.000	1008	0.857	0.886	H0Z871.pdb.gz	H0Z871_TAEGU sn-1-specific diacylglycerol lipase OS=Taeniopygia guttata OX=59729 GN=DAGLA PE=4 SV=2
3	AFDB:Q6WQJ1	0.657	0.656	0.000	1044	0.973	0.971	Q6WQJ1.pdb.gz	DGLA_MOUSE Diacylglycerol lipase-alpha OS=Mus musculus OX=10090 GN=Dagla PE=1 SV=2
4	AFDB:E7F0B3	0.641	0.636	1.171E-100	1051	0.673	0.667	E7F0B3.pdb.gz	E7F0B3_DANRE sn-1-specific diacylglycerol lipase OS=Danio rerio OX=7955 GN=dagla PE=4 SV=3
5	AFDB:A0A2R8Q244	0.642	0.623	5.168E-98	1076	0.670	0.649	A0A2R8Q244.pdb.gz
6	PDB:1uwcA	0.146	0.561	6.515E-8	261	0.029	0.115	1uwcA.pdb.gz	Structure of a Feruloyl Esterase from Aspergillus Niger
7	PDB:7xjpA	0.147	0.250	2.171E-5	580	0.049	0.088	7xjpA.pdb.gz	TIR-catalyzed ADP-ribosylation reactions produce signaling molecules for plant immunity.
8	PDB:7xeyA	0.152	0.244	9.278E-5	614	0.047	0.080	7xeyA.pdb.gz	Identification and receptor mechanism of TIR-catalyzed small molecules in plant immunity.
9	PDB:7xeyB	0.108	0.207	3.610E-4	519	0.032	0.064	7xeyB.pdb.gz	Identification and receptor mechanism of TIR-catalyzed small molecules in plant immunity.
10	PDB:7x0cA	0.161	0.379	4.154E-4	402	0.041	0.107	7x0cA.pdb.gz
11	PDB:3aikA	0.076	0.232	3.730E-2	283	0.026	0.095	3aikA.pdb.gz
12	PDB:3fcxB	0.093	0.271	1.095E-1	275	0.035	0.131	3fcxB.pdb.gz	Crystal structure of human esterase D: a potential genetic marker of retinoblastoma
13	PDB:5l2pA	0.086	0.235	1.521E-1	306	0.033	0.111	5l2pA.pdb.gz
14	PDB:4n8eB	0.062	0.083	1.750E-1	734	0.019	0.027	4n8eB.pdb.gz	Discovery of C-(1-aryl-cyclohexyl)-methylamines as selective, orally available inhibitors of dipeptidyl peptidase IV.
15	PDB:2gbfA	0.080	0.109	2.014E-1	730	0.027	0.038	2gbfA.pdb.gz	Crystal Structures of DPP-IV (CD26) from Rat Kidney Exhibit Flexible Accommodation of Peptidase-Selective Inhibitors.
16	AFDB:Q6K8X6	0.061	0.083	7.630E-1	688	0.088	0.134	Q6K8X6.pdb.gz	ORR23_ORYSJ Two-component response regulator ORR23 OS=Oryza sativa subsp. japonica OX=39947 GN=RR23 PE=2 SV=1
17	AFDB:Q14684	0.048	0.057	2.833	758	0.084	0.116	Q14684.pdb.gz	RRP1B_HUMAN Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B PE=1 SV=3
18	AFDB:Q94LW1	0.053	0.074	2.833	631	0.077	0.127	Q94LW1.pdb.gz	Q94LW1_MAIZE Two-component response regulator OS=Zea mays OX=4577 GN=ZmRR9 PE=2 SV=1
19	AFDB:Q9C105	0.050	0.044	3.580	1236	0.093	0.078	Q9C105.pdb.gz	YKT4_SCHPO Chitinase-like protein PB1E7.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB1E7.04c PE=3 SV=1
20	AFDB:Q0WLC6	0.038	0.037	4.318	1089	0.053	0.051	Q0WLC6.pdb.gz	PP349_ARATH Pentatricopeptide repeat-containing protein MRL1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MRL1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7Z150	0.0	567	1318	0.287	0.227	B7Z150_DROME Inactivation no afterpotential E, isoform E OS=Drosophila melanogaster OX=7227 GN=inaE PE=4 SV=1
2	B7Z151	0.0	558	815	0.287	0.367	B7Z151_DROME Inactivation no afterpotential E, isoform F OS=Drosophila melanogaster OX=7227 GN=inaE PE=4 SV=1
3	E7F0B3	0.0	1351	1051	0.669	0.663	E7F0B3_DANRE sn-1-specific diacylglycerol lipase OS=Danio rerio OX=7955 GN=dagla PE=4 SV=3
4	H0Z867	0.0	1863	1031	0.880	0.889	H0Z867_TAEGU sn-1-specific diacylglycerol lipase OS=Taeniopygia guttata OX=59729 GN=DAGLA PE=4 SV=2
5	H0Z871	0.0	1805	1008	0.858	0.887	H0Z871_TAEGU sn-1-specific diacylglycerol lipase OS=Taeniopygia guttata OX=59729 GN=DAGLA PE=4 SV=2
6	Q6WQJ1	0.0	2086	1044	0.974	0.972	DGLA_MOUSE Diacylglycerol lipase-alpha OS=Mus musculus OX=10090 GN=Dagla PE=1 SV=2
7	Q86B55	0.0	559	737	0.287	0.406	Q86B55_DROME Diacylglycerol lipase isoform D OS=Drosophila melanogaster OX=7227 GN=inaE PE=2 SV=1
8	Q9Y4D2	0.0	2147	1042	1.000	1.000	DGLA_HUMAN Diacylglycerol lipase-alpha OS=Homo sapiens OX=9606 GN=DAGLA PE=1 SV=3
9	X2JBS2	0.0	573	1310	0.285	0.227	X2JBS2_DROME Inactivation no afterpotential E, isoform G OS=Drosophila melanogaster OX=7227 GN=inaE PE=4 SV=1
10	X2JDP4	0.0	565	729	0.285	0.407	X2JDP4_DROME Inactivation no afterpotential E, isoform H OS=Drosophila melanogaster OX=7227 GN=inaE PE=4 SV=1
11	Q8MR12	6.44e-173	522	644	0.265	0.429	Q8MR12_DROME Diacylglycerol lipase isoform A OS=Drosophila melanogaster OX=7227 GN=inaE PE=2 SV=1
12	Q8NCG7	5.33e-111	361	672	0.228	0.354	DGLB_HUMAN Diacylglycerol lipase-beta OS=Homo sapiens OX=9606 GN=DAGLB PE=1 SV=2
13	Q91WC9	7.68e-104	342	669	0.224	0.348	DGLB_MOUSE Diacylglycerol lipase-beta OS=Mus musculus OX=10090 GN=Daglb PE=1 SV=2
14	E7ET49	2.40e-100	331	631	0.215	0.355	E7ET49_HUMAN sn-1-specific diacylglycerol lipase OS=Homo sapiens OX=9606 GN=DAGLB PE=1 SV=1
15	A2R709	0.048	39.7	297	0.030	0.104	A2R709_ASPNC Contig An16c0070, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An16g01880 PE=4 SV=1
16	Q2U7Y9	0.077	38.9	306	0.036	0.124	Q2U7Y9_ASPOR Mono-and diacylglycerol lipase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090701000644 PE=4 SV=1
17	Q9C8G6	0.26	37.7	529	0.041	0.081	Q9C8G6_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=DLAH PE=4 SV=1
18	O43042	1.4	35.0	326	0.041	0.132	RM03_SCHPO Large ribosomal subunit protein mL44 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mrpl3 PE=3 SV=1
19	Q387R7	1.5	35.0	564	0.039	0.073	Q387R7_TRYB2 Class 3 lipase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.0300 PE=4 SV=1
20	B1Q560	4.4	33.5	392	0.033	0.087	B1Q560_RHIOR Lipase preproprotein OS=Rhizopus oryzae OX=64495 GN=ROL PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12697 Abhydrolase_6	71	15.4	Alpha/beta hydrolase family
2	PF01764 Lipase_3	8e-07	40.5	Lipase (class 3)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257215

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000407112	0.937	N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D
2	9606.ENSP00000243167	0.886	Fatty-acid amide hydrolase 1
3	9606.ENSP00000420315	0.877	Monoacylglycerol lipase ABHD6
4	9606.ENSP00000265052	0.875	Monoglyceride lipase
5	9606.ENSP00000358513	0.869	Cannabinoid receptor 1
6	9606.ENSP00000297056	0.834	Sn1-specific diacylglycerol lipase beta
7	9606.ENSP00000365725	0.803	Monoacylglycerol lipase ABHD12
8	9606.ENSP00000364035	0.801	Fatty-acid amide hydrolase 2
9	9606.ENSP00000306138	0.749	Metabotropic glutamate receptor 5
10	9606.ENSP00000414558	0.688	Protein ABHD4
11	9606.ENSP00000375894	0.681	G-protein coupled receptor 55
12	9606.ENSP00000286733	0.623	N-acylethanolamine-hydrolyzing acid amidase
13	9606.ENSP00000222345	0.608	Signal-induced proliferation-associated 1-like protein 3
14	9606.ENSP00000459962	0.607	Transient receptor potential cation channel, subfamily V, member 1
15	9606.ENSP00000461007	0.607	Transient receptor potential cation channel subfamily V member 1
16	9606.ENSP00000221498	0.589	Dickkopf-like protein 1
17	9606.ENSP00000379472	0.552	Cholecystokinin
18	9606.ENSP00000263655	0.536	CB1 cannabinoid receptor-interacting protein 1
19	9606.ENSP00000261386	0.534	Glycerophosphodiester phosphodiesterase 1
20	9606.ENSP00000363596	0.514	Cannabinoid receptor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0052689	1.000	carboxylic ester hydrolase activity
GO:0016298	1.000	lipase activity
GO:0005515	0.997	protein binding
GO:0004465	0.957	lipoprotein lipase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0032787	0.994	monocarboxylic acid metabolic process
GO:0120254	0.993	olefinic compound metabolic process
GO:0006690	0.993	icosanoid metabolic process
GO:0006629	0.988	lipid metabolic process
GO:0065007	0.977	biological regulation
GO:0033559	0.965	unsaturated fatty acid metabolic process
GO:0001676	0.965	long-chain fatty acid metabolic process
GO:0023052	0.952	signaling
GO:0007154	0.952	cell communication
GO:0019369	0.949	arachidonic acid metabolic process
GO:0050789	0.923	regulation of biological process
GO:0050794	0.907	regulation of cellular process
GO:0050896	0.862	response to stimulus
GO:0051716	0.789	cellular response to stimulus
GO:0007165	0.711	signal transduction
GO:0042133	0.637	neurotransmitter metabolic process
GO:0007267	0.562	cell-cell signaling
GO:0044249	0.526	cellular biosynthetic process
GO:0032501	0.397	multicellular organismal process
GO:0007186	0.342	G protein-coupled receptor signaling pathway
GO:0046486	0.329	glycerolipid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0036477	0.997	somatodendritic compartment
GO:0005622	0.996	intracellular anatomical structure
GO:0005737	0.992	cytoplasm
GO:0012505	0.989	endomembrane system
GO:0005886	0.989	plasma membrane
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0031090	0.936	organelle membrane
GO:0042995	0.629	cell projection
GO:0043005	0.617	neuron projection
GO:0030054	0.608	cell junction
GO:0098590	0.591	plasma membrane region
GO:0045202	0.406	synapse
GO:0031974	0.395	membrane-enclosed lumen
GO:0070013	0.394	intracellular organelle lumen
GO:0031981	0.370	nuclear lumen
GO:0098794	0.352	postsynapse
GO:0031253	0.337	cell projection membrane
GO:0005829	0.336	cytosol
GO:0030425	0.314	dendrite

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.1.-	1.000	Carboxylic ester hydrolases.
EC:3.1.1.34	0.957	lipoprotein lipase.

[back to server]