StarFunc result for job id Q9Y4D7

User Input

>input (1925 residues)
MAPRAAGGAPLSARAAAASPPPFQTPPRCPVPLLLLLLLGAARAGALEIQRRFPSPTPTN
NFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVPDSPLCHAPQLPQASCEHPRRL
TDNYNKILQLDPGQGLVVVCGSIYQGFCQLRRRGNISAVAVRFPPAAPPAEPVTVFPSML
NVAANHPNASTVGLVLPPAAGAGGSRLLVGATYTGYGSSFFPRNRSLEDHRFENTPEIAI
RSLDTRGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVSAFLHPSDPPPGAQSYAYLA
LNSEARAGDKESQARSLLARICLPHGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSRLVS
VFPARERLFAVFERPQGSPAARAAPAALCAFRFADVRAAIRAARTACFVEPAPDVVAVLD
SVVQGTGPACERKLNIQLQPEQLDCGAAHLQHPLSILQPLKATPVFRAPGLTSVAVASVN
NYTAVFLGTVNGRLLKINLNESMQVVSRRVVTVAYGEPVHHVMQFDPADSGYLYLMTSHQ
MARVKVAACNVHSTCGDCVGAADAYCGWCALETRCTLQQDCTNSSQQHFWTSASEGPSRC
PAMTVLPSEIDVRQEYPGMILQISGSLPSLSGMEMACDYGNNIRTVARVPGPAFGHQIAY
CNLLPRDQFPPFPPNQDHVTVEMSVRVNGRNIVKANFTIYDCSRTAQVYPHTACTSCLSA
QWPCFWCSQQHSCVSNQSRCEASPNPTSPQDCPRTLLSPLAPVPTGGSQNILVPLANTAF
FQGAALECSFGLEEIFEAVWVNESVVRCDQVVLHTTRKSQVFPLSLQLKGRPARFLDSPE
PMTVMVYNCAMGSPDCSQCLGREDLGHLCMWSDGCRLRGPLQPMAGTCPAPEIHAIEPLS
GPLDGGTLLTIRGRNLGRRLSDVAHGVWIGGVACEPLPDRYTVSEEIVCVTGPAPGPLSG
VVTVNASKEGKSRDRFSYVLPLVHSLEPTMGPKAGGTRITIHGNDLHVGSELQVLVNDTD
PCTELMRTDTSIACTMPEGALPAPVPVCVRFERRGCVHGNLTFWYMQNPVITAISPRRSP
VSGGRTITVAGERFHMVQNVSMAVHHIGREPTLCKVLNSTLITCPSPGALSNASAPVDFF
INGRAYADEVAVAEELLDPEEAQRGSRFRLDYLPNPQFSTAKREKWIKHHPGEPLTLVIH
KEQDSLGLQSHEYRVKIGQVSCDIQIVSDRIIHCSVNESLGAAVGQLPITIQVGNFNQTI
ATLQLGGSETAIIVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIRE
EIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSQTLNS
QGSSQAQETHPLLGEWKIPESCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAVRD
RCSLASLLTIALHGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSI
CMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLSEEWLLRENIEAKPRNLNV
SFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYIL
RDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLIDKKDNTLGRVKDLDTEKYFHLVLPT
DELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYF
FDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQ
AFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIQDMTPLSEQEMNAHLAEE
SRKYQNEFNTNVAMAEIYKYAKRYRPQIMAALEANPTARRTQLQHKFEQVVALMEDNIYE
CYSEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QPJ6	0.735	0.743	0.000	1902	0.317	0.321	A0A2R8QPJ6.pdb.gz	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1
2	AFDB:B0S5N4	0.615	0.624	0.000	1892	0.316	0.322	B0S5N4.pdb.gz	PLXA3_DANRE Plexin A3 OS=Danio rerio OX=7955 GN=plxna3 PE=2 SV=2
3	AFDB:B2RXS4	0.598	0.618	0.000	1842	0.324	0.339	B2RXS4.pdb.gz	PLXB2_MOUSE Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1
4	AFDB:D3ZLH5	0.549	0.554	0.000	1902	0.345	0.349	D3ZLH5.pdb.gz	PLXB3_RAT Plexin-B3 OS=Rattus norvegicus OX=10116 GN=Plxnb3 PE=1 SV=1
5	AFDB:F1Q7U0	0.442	0.391	0.000	2220	0.342	0.296	F1Q7U0.pdb.gz	F1Q7U0_DANRE Plexin b1b OS=Danio rerio OX=7955 GN=plxnb1b PE=1 SV=1
6	AFDB:F1QBC0	0.472	0.486	0.000	1864	0.316	0.326	F1QBC0.pdb.gz	F1QBC0_DANRE Plexin b2a OS=Danio rerio OX=7955 GN=fk37b01 PE=1 SV=3
7	AFDB:O15031	0.545	0.563	0.000	1838	0.332	0.348	O15031.pdb.gz	PLXB2_HUMAN Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3
8	AFDB:O43157	0.427	0.390	0.000	2135	0.355	0.320	O43157.pdb.gz	PLXB1_HUMAN Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3
9	AFDB:O75051	0.566	0.573	0.000	1894	0.321	0.326	O75051.pdb.gz	PLXA2_HUMAN Plexin-A2 OS=Homo sapiens OX=9606 GN=PLXNA2 PE=1 SV=4
10	AFDB:P70208	0.581	0.593	0.000	1872	0.308	0.317	P70208.pdb.gz	PLXA3_MOUSE Plexin-A3 OS=Mus musculus OX=10090 GN=Plxna3 PE=1 SV=2
11	PDB:6vxkB	0.229	0.505	1.110E-28	747	0.099	0.256	6vxkB.pdb.gz
12	PDB:6qp7A	0.197	0.548	2.750E-19	620	0.057	0.176	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
13	PDB:3nvqA	0.184	0.523	4.361E-15	588	0.055	0.180	3nvqA.pdb.gz
14	PDB:1e07A	0.062	0.144	7.568E-9	642	0.034	0.103	1e07A.pdb.gz
15	PDB:4aq1A	0.058	0.115	6.349E-8	721	0.044	0.117	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
16	PDB:3nvnA	0.141	0.578	1.731E-7	383	0.029	0.144	3nvnA.pdb.gz	Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
17	PDB:7q5zA	0.069	0.088	8.620E-7	1344	0.041	0.058	7q5zA.pdb.gz
18	PDB:6xk9Y	0.090	0.133	1.237E-6	1106	0.064	0.111	6xk9Y.pdb.gz	CC-90009, a novel cereblon E3 ligase modulator, targets acute myeloid leukemia blasts and leukemia stem cells.
19	PDB:7q1yA	0.074	0.092	1.288E-6	1374	0.043	0.060	7q1yA.pdb.gz
20	PDB:4lnvA	0.084	0.111	2.002E-6	1276	0.044	0.067	4lnvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A2R8QPJ6	896	1902	0.330	0.334	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1
2	A8IYK2	876	1885	0.336	0.343	A8IYK2_DANRE Plexin-A1 OS=Danio rerio OX=7955 GN=plxna1 PE=1 SV=1
3	B0S5N4	872	1892	0.326	0.332	PLXA3_DANRE Plexin A3 OS=Danio rerio OX=7955 GN=plxna3 PE=2 SV=2
4	B2RXS4	924	1842	0.336	0.351	PLXB2_MOUSE Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1
5	C5H5I1	867	1864	0.324	0.335	C5H5I1_DANRE Plexin B2 OS=Danio rerio OX=7955 GN=plxnB2 PE=1 SV=1
6	D3ZLH5	935	1902	0.359	0.363	PLXB3_RAT Plexin-B3 OS=Rattus norvegicus OX=10116 GN=Plxnb3 PE=1 SV=1
7	F1Q7U0	737	2220	0.229	0.199	F1Q7U0_DANRE Plexin b1b OS=Danio rerio OX=7955 GN=plxnb1b PE=1 SV=1
8	F1QBC0	865	1864	0.324	0.335	F1QBC0_DANRE Plexin b2a OS=Danio rerio OX=7955 GN=fk37b01 PE=1 SV=3
9	H9XVP3	907	1928	0.335	0.334	H9XVP3_DROME Plexin A, isoform F OS=Drosophila melanogaster OX=7227 GN=PlexA PE=1 SV=1
10	O15031	940	1838	0.345	0.361	PLXB2_HUMAN Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3
11	O43157	783	2135	0.251	0.227	PLXB1_HUMAN Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3
12	O75051	896	1894	0.334	0.339	PLXA2_HUMAN Plexin-A2 OS=Homo sapiens OX=9606 GN=PLXNA2 PE=1 SV=4
13	O96681	896	1945	0.333	0.330	O96681_DROME Plexin A OS=Drosophila melanogaster OX=7227 GN=PlexA PE=2 SV=1
14	P51805	860	1871	0.328	0.338	PLXA3_HUMAN Plexin-A3 OS=Homo sapiens OX=9606 GN=PLXNA3 PE=1 SV=3
15	P70206	864	1894	0.332	0.338	PLXA1_MOUSE Plexin-A1 OS=Mus musculus OX=10090 GN=Plxna1 PE=1 SV=1
16	P70207	884	1894	0.331	0.336	PLXA2_MOUSE Plexin-A2 OS=Mus musculus OX=10090 GN=Plxna2 PE=1 SV=2
17	P70208	868	1872	0.331	0.341	PLXA3_MOUSE Plexin-A3 OS=Mus musculus OX=10090 GN=Plxna3 PE=1 SV=2
18	Q0KIF1	820	1505	0.278	0.355	Q0KIF1_DROME Plexin A, isoform B OS=Drosophila melanogaster OX=7227 GN=PlexA PE=1 SV=1
19	Q3UH93	3576	1925	0.897	0.897	PLXD1_MOUSE Plexin-D1 OS=Mus musculus OX=10090 GN=Plxnd1 PE=1 SV=1
20	Q3V5K0	716	1945	0.300	0.297	Q3V5K0_CAEEL Sema domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=plx-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17870 Insulin_TMD	1.5e+02	13.9	Insulin receptor trans-membrane segment
2	PF08337 Plexin_cytopl	4.7e-189	640.5	Plexin cytoplasmic RasGAP domain
3	PF20170 Plexin_RBD	3.3e-37	138.5	Plexin cytoplasmic RhoGTPase-binding domain
4	PF01437 PSI	4.5e-10	51.2	Plexin repeat
5	PF01403 Sema	3e-11	55.0	Sema domain
6	PF15330 SIT	3.9e+02	12.9	SHP2-interacting transmembrane adaptor protein, SIT
7	PF01833 TIG	8.5e-34	126.8	IPT/TIG domain
8	PF17960 TIG_plexin	7e-05	34.0	TIG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000317128

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303212	0.999	Semaphorin-3E
2	9606.ENSP00000265371	0.998	Neuropilin-1
3	9606.ENSP00000357268	0.998	Semaphorin-4A
4	9606.ENSP00000265361	0.995	Semaphorin-3C
5	9606.ENSP00000466680	0.995	Rho-related GTP-binding protein RhoN
6	9606.ENSP00000263923	0.977	Vascular endothelial growth factor receptor 2
7	9606.ENSP00000484146	0.974	Semaphorin-3B
8	9606.ENSP00000246792	0.961	Ras-related protein R-Ras
9	9606.ENSP00000269571	0.938	Receptor tyrosine-protein kinase erbB-2
10	9606.ENSP00000277541	0.932	Neurogenic locus notch homolog protein 1
11	9606.ENSP00000416523	0.925	Semaphorin-4D
12	9606.ENSP00000265362	0.920	Semaphorin-3A
13	9606.ENSP00000284136	0.916	Semaphorin-3D
14	9606.ENSP00000357909	0.916	Semaphorin-6C
15	9606.ENSP00000257414	0.911	Semaphorin-6A
16	9606.ENSP00000263388	0.911	Neurogenic locus notch homolog protein 3
17	9606.ENSP00000345206	0.905	Recombining binding protein suppressor of hairless
18	9606.ENSP00000225916	0.903	Histone acetyltransferase KAT2A
19	9606.ENSP00000262367	0.902	CREB-binding protein
20	9606.ENSP00000263253	0.902	Histone acetyltransferase p300

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0017154	1.000	semaphorin receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050896	0.989	response to stimulus
GO:0023052	0.988	signaling
GO:0050794	0.988	regulation of cellular process
GO:0051716	0.981	cellular response to stimulus
GO:0048856	0.979	anatomical structure development
GO:0007154	0.979	cell communication
GO:0007275	0.966	multicellular organism development
GO:0071526	0.964	semaphorin-plexin signaling pathway
GO:0048731	0.929	system development
GO:0009653	0.907	anatomical structure morphogenesis
GO:0007399	0.903	nervous system development
GO:0040012	0.880	regulation of locomotion
GO:0048869	0.801	cellular developmental process
GO:0030154	0.784	cell differentiation
GO:0016477	0.738	cell migration
GO:0048513	0.716	animal organ development
GO:0035239	0.708	tube morphogenesis
GO:0048646	0.706	anatomical structure formation involved in morphogenesis
GO:0048518	0.670	positive regulation of biological process
GO:0071840	0.656	cellular component organization or biogenesis
GO:0016043	0.645	cellular component organization
GO:0048522	0.627	positive regulation of cellular process
GO:0001763	0.595	morphogenesis of a branching structure
GO:0048754	0.567	branching morphogenesis of an epithelial tube
GO:0072359	0.502	circulatory system development
GO:0048519	0.474	negative regulation of biological process
GO:0048523	0.457	negative regulation of cellular process
GO:0030334	0.390	regulation of cell migration
GO:0001944	0.366	vasculature development
GO:0051128	0.361	regulation of cellular component organization
GO:0001525	0.356	angiogenesis
GO:0048583	0.340	regulation of response to stimulus
GO:0048468	0.332	cell development
GO:0019222	0.326	regulation of metabolic process
GO:0050793	0.325	regulation of developmental process
GO:0031323	0.324	regulation of cellular metabolic process
GO:0030182	0.319	neuron differentiation
GO:0051239	0.315	regulation of multicellular organismal process
GO:0051171	0.308	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.724	organelle
GO:0043227	0.714	membrane-bounded organelle
GO:0042995	0.583	cell projection
GO:0043229	0.568	intracellular organelle
GO:0120025	0.562	plasma membrane bounded cell projection
GO:0031252	0.369	cell leading edge
GO:0005737	0.301	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]