StarFunc result for job id Q9Y4D8

User Input

>input (1400 residues)
MPANHLPIGSTMSTVHLSSDGTYFYWIWSPASLNEKTPKGHSVFMDIFELVVENGVFVAN
PLQERTILMRKEGESAKSINEMLLSRLSRYRASPSATLAALTGSTISNTLKEDQAANTSC
GLPLKMLRKTPIYTCGTYLVMLVPPPGGSGSSATRSLFGGTSGLSSLKRACYDTVNNMLW
TCSNDYIDQWCNPGNQAFHYVCQRLGVSHIITEPKEEAITTNEVINQLLHHVGAMCIHQL
NLLATNPNLPITSVLGKQHPIEAHHLSSICDIMEKAMVNGDTCIIRCILVVFQVVFKFFF
SPQTERNRDIIRRSGLLLWQLLMAPKDQICPEIQKEVCLAISSGLNILYPGETEINNLLK
LVLTEGERNSGLSQLRDVILTNLAEQLQNNRFGSDEDDHYRLNDELLHYILKIVVRESCI
LITKCQTVSKDDFQKLLSTVPAASSCLRYLMAVQNHLLSNTILIKPDENDDSDSSLQGET
LKVQELKVSILALATQILTGCDEVLEMLQQVTTALINSDIADREQRLKGLEQVTKATMLG
HLLPVLLTSLMHPNLQTLIMADALMPQLVQLVLYTSQTALLLKTQCPVFAEVGCSPCGAP
DQKCRLFPDERMLEEKEEPGFLTGLKIPAPWAAGKTVETVHPVRDNYKFKETVHIPGARC
LYLRFDSRCSSQYDYDKLVIYAGPNTNSRKVAEYGGNTLGYGSRSVLGTGWPKDLVKCIS
PPSLNFKVEGDTVTFSFEMRSGREHNTPDKAMWGFACTVRAQESSEDVSGGLPFLVDLAL
GLSVLACSMLRILYNGPEITKEEEACQELLRSKLLQRCQWQVEANGVISPALTPSPSPLP
LTIEEDREFTYPSDVLVPPVGNYFDLPRIRLPPGIMIKLREISGRARPQFRPSIKEVIQP
DVMEEMVVSCVIKHLNLVDALQSLINFQYQEEHAEEYDLLCKIMGETFKKLNAMERQLQS
VAELEQKWQSEVDDAMQGKLENNMPFFYDYHFNENKMKELELLCSMKEVSFDGNDLENMV
LSLREKFLQEVNSLIQKPSHPLAKTKTLVKSLMNRAELLLHVTIAAQSGLTRSISGTPAE
TPACKSASETKVISHAVRQPVFLRSMSAPSDLEMIGNEDLEFTRANQRRRHVTSHRSSSF
TLLQSLAIEDSRDKPTYSVLLGQLFAFIGTNPDQAVSSSSFLLAAQTRWRRGNTRKQALV
HMRELLTAAVRVGGVTHLVGPVTMVLQGGPRIEELTCGGMVEQVQEAFGETMTSVVSLCA
RYPIACANSIGLLCTIPYTRSEEKCLVRSGLVQLMDRLCSLSNQTESSSSEKQTKKQKVA
TMAWAAFQVLANRCVEWEKEEGGSTEAVHSGLARQVSSLLTNHLARATECCGNQAAGNDA
LQDVLSLLNDLSRSHIGKAI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7sudA	0.102	0.053	1.594E-4	3740	0.099	0.037	7sudA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
2	PDB:5ijoJ	0.095	0.101	5.856E-4	1256	0.091	0.101	5ijoJ.pdb.gz
3	PDB:7sglA	0.097	0.050	6.084E-4	3852	0.096	0.035	7sglA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
4	PDB:3gjxA	0.121	0.149	3.037E-3	1041	0.089	0.120	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
5	PDB:7mqaLM	0.087	0.067	4.286E-3	2041	0.100	0.069	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
6	PDB:7nfeA	0.091	0.049	4.286E-3	3585	0.099	0.038	7nfeA.pdb.gz	Cryo-EM of NHEJ supercomplexes provides insights into DNA repair.
7	PDB:7t3rA	0.122	0.090	4.453E-3	2130	0.093	0.061	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
8	AFDB:Q57Z38	0.085	0.116	4.607E-3	861	0.075	0.122	Q57Z38.pdb.gz	Q57Z38_TRYB2 TOG domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.45E22.410 PE=4 SV=1
9	AFDB:Q19317	0.100	0.068	5.796E-3	2507	0.095	0.053	Q19317.pdb.gz	NBEA_CAEEL Putative neurobeachin homolog OS=Caenorhabditis elegans OX=6239 GN=sel-2 PE=2 SV=3
10	AFDB:B5BT18	0.114	0.083	6.257E-3	2045	0.095	0.065	B5BT18.pdb.gz	BTAF1_ARATH TATA-binding protein-associated factor BTAF1 OS=Arabidopsis thaliana OX=3702 GN=BTAF1 PE=1 SV=1
11	AFDB:G5EFJ4	0.102	0.119	6.502E-3	1153	0.084	0.101	G5EFJ4.pdb.gz	CAPG1_CAEEL Condensin complex subunit capg-1 OS=Caenorhabditis elegans OX=6239 GN=capg-1 PE=1 SV=1
12	PDB:4a0cA	0.086	0.100	6.530E-3	1155	0.084	0.102	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
13	PDB:6vaeA	0.066	0.071	7.050E-3	1198	0.109	0.127	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
14	PDB:7mopA	0.096	0.062	7.050E-3	2445	0.086	0.049	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
15	AFDB:Q86I66	0.121	0.084	1.899E-2	2284	0.097	0.060	Q86I66.pdb.gz	Q86I66_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=zizA PE=3 SV=1
16	AFDB:O74476	0.093	0.109	2.893E-2	1095	0.088	0.112	O74476.pdb.gz	IMB3_SCHPO Importin subunit beta-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sal3 PE=3 SV=1
17	AFDB:Q5B163	0.140	0.169	3.123E-2	1095	0.096	0.123	Q5B163.pdb.gz	Q5B163_EMENI Importin beta-3 subunit, putative (AFU_orthologue AFUA_1G06790) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05717 PE=3 SV=1
18	AFDB:Q57Z70	0.110	0.083	7.533E-2	2181	0.101	0.065	Q57Z70.pdb.gz	Q57Z70_TRYB2 Non-specific serine/threonine protein kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.27M3.280 PE=4 SV=1
19	AFDB:Q9UPR3	0.109	0.135	8.133E-2	1016	0.096	0.133	Q9UPR3.pdb.gz	SMG5_HUMAN Nonsense-mediated mRNA decay factor SMG5 OS=Homo sapiens OX=9606 GN=SMG5 PE=1 SV=3
20	AFDB:D6W5U7	0.095	0.105	1.239E-1	1226	0.054	0.062	D6W5U7.pdb.gz	D6W5U7_HUMAN Cohesin subunit SA OS=Homo sapiens OX=9606 GN=STAG3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y4D8	0.0	2904	3996	1.000	0.350	HECD4_HUMAN Probable E3 ubiquitin-protein ligase HECTD4 OS=Homo sapiens OX=9606 GN=HECTD4 PE=1 SV=5
2	O43149	0.001	46.2	2961	0.023	0.011	ZZEF1_HUMAN Zinc finger ZZ-type and EF-hand domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZZEF1 PE=1 SV=6
3	Q4U2R1	0.001	45.8	4836	0.026	0.007	HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus OX=10090 GN=Herc2 PE=1 SV=3
4	O95714	0.004	44.3	4834	0.014	0.004	HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2
5	Q54L33	0.013	42.7	5222	0.033	0.009	Q54L33_DICDI HECT domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286931 PE=4 SV=1
6	O70244	0.53	37.4	3623	0.032	0.012	CUBN_RAT Cubilin OS=Rattus norvegicus OX=10116 GN=Cubn PE=1 SV=2
7	Q5SSH7	1.9	35.4	2924	0.026	0.013	ZZEF1_MOUSE Zinc finger ZZ-type and EF-hand domain-containing protein 1 OS=Mus musculus OX=10090 GN=Zzef1 PE=1 SV=2
8	Q9VA00	2.6	35.0	641	0.026	0.058	ZWILC_DROME Protein zwilch OS=Drosophila melanogaster OX=7227 GN=Zwilch PE=1 SV=1
9	Q8NGJ5	7.5	33.1	315	0.021	0.092	O51L1_HUMAN Olfactory receptor 51L1 OS=Homo sapiens OX=9606 GN=OR51L1 PE=3 SV=1
10	O92956	9.0	33.1	1603	0.014	0.012	POL_RSVSB Gag-Pol polyprotein OS=Rous sarcoma virus subgroup B (strain Schmidt-Ruppin) OX=269447 GN=gag-pol PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000049901

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000060424	0.680	Uncharacterized protein
2	9598.ENSPTRP00000009585	0.675	GTP-binding nuclear protein Ran
3	9598.ENSPTRP00000053725	0.649	Uncharacterized protein
4	9598.ENSPTRP00000009271	0.648	Pan troglodytes BRCA1 associated protein (BRAP), mRNA
5	9598.ENSPTRP00000021122	0.642	E3 SUMO-protein ligase RanBP2
6	9598.ENSPTRP00000015867	0.635	Uncharacterized protein
7	9598.ENSPTRP00000016376	0.633	Uncharacterized protein
8	9598.ENSPTRP00000014078	0.601	Nuclear transport factor 2
9	9598.ENSPTRP00000034690	0.562	RP1, axonemal microtubule associated
10	9598.ENSPTRP00000009256	0.552	Uncharacterized protein
11	9598.ENSPTRP00000044045	0.551	Ran GTPase activating protein 1
12	9598.ENSPTRP00000038900	0.549	Tripartite motif containing 45
13	9598.ENSPTRP00000020820	0.548	Transmembrane protein 150A
14	9598.ENSPTRP00000016374	0.542	Functions as a component of the nuclear pore complex (NPC).
15	9598.ENSPTRP00000000827	0.538	Importin subunit alpha
16	9598.ENSPTRP00000003987	0.538	Pan troglodytes sperm associated antigen 6 (SPAG6), mRNA
17	9598.ENSPTRP00000010000	0.538	Importin subunit alpha
18	9598.ENSPTRP00000026363	0.538	Importin subunit alpha
19	9598.ENSPTRP00000026815	0.538	Importin subunit alpha
20	9598.ENSPTRP00000031651	0.538	Importin subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.891	primary metabolic process
GO:0071704	0.889	organic substance metabolic process
GO:0019318	0.861	hexose metabolic process
GO:0033500	0.860	carbohydrate homeostasis
GO:0006006	0.816	glucose metabolic process
GO:0042593	0.795	glucose homeostasis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0043229	0.988	intracellular organelle
GO:0043231	0.981	intracellular membrane-bounded organelle
GO:0005737	0.978	cytoplasm
GO:0016020	0.958	membrane
GO:0005829	0.928	cytosol
GO:0005634	0.863	nucleus
GO:0012505	0.647	endomembrane system
GO:0005635	0.439	nuclear envelope
GO:0005815	0.399	microtubule organizing center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]