StarFunc result for job id Q9Y4E1

User Input

>input (1320 residues)
MMNRTTPDQELVPASEPVWERPWSVEEIRRSSQSWSLAADAGLLQFLQEFSQQTISRTHE
IKKQVDGLIRETKATDCRLHNVFNDFLMLSNTQFIENRVYDEEVEEPVLKAEAEKTEQEK
TREQKEVDLIPKVQEAVNYGLQVLDSAFEQLDIKAGNSDSEEDDANGRVELILEPKDLYI
DRPLPYLIGSKLFMEQEDVGLGELSSEEGSVGSDRGSIVDTEEEKEEEESDEDFAHHSDN
EQNQHTTQMSDEEEDDDGCDLFADSEKEEEDIEDIEENTRPKRSRPTSFADELAARIKGD
AMGRVDEEPTTLPSGEAKPRKTLKEKKERRTPSDDEEDNLFAPPKLTDEDFSPFGSGGGL
FSGGKGLFDDEDEESDLFTEASQDRQAGASVKEESSSSKPGKKIPAGAVSVFLGDTDVFG
AASVPSLKEPQKPEQPTPRKSPYGPPPTGLFDDDDGDDDDDFFSAPHSKPSKTRKVQSTA
DIFGDEEGDLFKEKAVASPEATVSQTDENKARAEKKVTLSYSKNLKPSSETKTQKGLFSD
EEDSEDLFSSQSASNLKGASLLPGKLPTSVSLFDDEDEEDNLFGGTAAKKQTLSLQAQRE
EKAKASELSKKKASALLFSSDEEDQWNIPASQTHLASDSRSKGEPRDSGTLQSQEAKAVK
KTSLFEEDKEDDLFAIAKDSQKKTQRVSLLFEDDVDSGGSLFGSPPTSVPPATKKKETVS
EAPPLLFSDEEEKEAQLGVKSVDKKVESAKESLKFGRTDVAESEKEGLLTRSAQETVKHS
DLFSSSSPWDKGTKPRTKTVLSLFDEEEDKMEDQNIIQAPQKEVGKGCDPDAHPKSTGVF
QDEELLFSHKLQKDNDPDVDLFAGTKKTKLLEPSVGSLFGDDEDDDLFSSAKSQPLVQEK
KRVVKKDHSVNSFKNQKHPESIQGSKEKGIWKPETPQANLAINPAALLPTAASQISEVKP
VLPELAFPSSEHRRSHGLESVPVLPGSGEAGVSFDLPAQADTLHSANKSRVKMRGKRRPQ
TRAARRLAAQESSEAEDMSVPRGPIAQWADGAISPNGHRPQLRAASGEDSTEEALAAAAA
PWEGGPVPGVDTSPFAKSLGHSRGEADLFDSGDIFSTGTGSQSVERTKPKAKIAENPANP
PVGGKAKSPMFPALGEASSDDDLFQSAKPKPAKKTNPFPLLEDEDDLFTDQKVKKNETKS
SSQQDVILTTQDIFEDDIFATEAIKPSQKTREKEKTLESNLFDDNIDIFADLTVKPKEKS
KKKVEAKSIFDDDMDDIFSTGIQAKTTKPKSRSAQAAPEPRFEHKVSNIFDDPLNAFGGQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A087WYF6	0.098	0.102	0.000	1245	0.929	0.985	A0A087WYF6.pdb.gz	A0A087WYF6_HUMAN WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=1
2	AFDB:E7ESD2	0.084	0.087	0.000	1279	0.956	0.987	E7ESD2.pdb.gz	E7ESD2_HUMAN WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=2
3	AFDB:Q641Q2	0.171	0.170	0.000	1341	0.986	0.970	Q641Q2.pdb.gz	WAC2A_HUMAN WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=3
4	AFDB:Q6PGL7	0.204	0.203	0.000	1334	0.737	0.729	Q6PGL7.pdb.gz	WASC2_MOUSE WASH complex subunit 2 OS=Mus musculus OX=10090 GN=Washc2 PE=1 SV=1
5	AFDB:Q9Y4E1	0.999	0.999	0.000	1320	1.000	1.000	Q9Y4E1.pdb.gz	WAC2C_HUMAN WASH complex subunit 2C OS=Homo sapiens OX=9606 GN=WASHC2C PE=1 SV=5
6	AFDB:A1ZBW7	0.064	0.058	6.605E-16	1469	0.210	0.189	A1ZBW7.pdb.gz	WASC2_DROME WASH complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=FAM21 PE=1 SV=1
7	AFDB:Q552E2	0.079	0.071	1.018E-10	1479	0.227	0.202	Q552E2.pdb.gz	WASC2_DICDI WASH complex subunit 2 OS=Dictyostelium discoideum OX=44689 GN=washc2 PE=1 SV=1
8	AFDB:Q70HU3	0.035	0.038	1.585E-2	1135	0.117	0.137	Q70HU3.pdb.gz	Q70HU3_DROME PNUTSDm protein OS=Drosophila melanogaster OX=7227 GN=PNUTS PE=2 SV=1
9	AFDB:Q96M83	0.061	0.059	2.672E-2	1385	0.128	0.122	Q96M83.pdb.gz	CCDC7_HUMAN Coiled-coil domain-containing protein 7 OS=Homo sapiens OX=9606 GN=CCDC7 PE=1 SV=3
10	AFDB:A0A024RAY1	0.038	0.039	4.809E-2	1270	0.125	0.130	A0A024RAY1.pdb.gz
11	PDB:5nrlG	0.030	0.092	1.624	372	0.017	0.062	5nrlG.pdb.gz	Structure of a pre-catalytic spliceosome.
12	PDB:7nacw	0.030	0.056	2.403	672	0.024	0.048	7nacw.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
13	PDB:6qlfQ	0.052	0.248	2.565	204	0.015	0.098	6qlfQ.pdb.gz
14	PDB:6zqdUN	0.030	0.131	4.051	203	0.013	0.084	6zqdUN.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
15	PDB:3c98B	0.025	0.112	5.615	230	0.016	0.091	3c98B.pdb.gz
16	PDB:7mq8SY	0.026	0.111	5.993	238	0.015	0.084	7mq8SY.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:5n9jG	0.044	0.256	6.829	163	0.010	0.080	5n9jG.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WYF6	0.0	2188	1245	0.930	0.986	A0A087WYF6_HUMAN WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=1
2	E7ESD2	0.0	2499	1279	0.957	0.987	E7ESD2_HUMAN WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=2
3	F8W7U3	0.0	2380	1253	0.914	0.963	F8W7U3_HUMAN WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=1
4	J3KP36	0.0	2442	1262	0.945	0.989	J3KP36_HUMAN WASH complex subunit 2C OS=Homo sapiens OX=9606 GN=WASHC2C PE=1 SV=3
5	Q641Q2	0.0	2587	1341	0.987	0.972	WAC2A_HUMAN WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=3
6	Q6PGL7	0.0	1623	1334	0.738	0.730	WASC2_MOUSE WASH complex subunit 2 OS=Mus musculus OX=10090 GN=Washc2 PE=1 SV=1
7	Q9Y4E1	0.0	2639	1320	1.000	1.000	WAC2C_HUMAN WASH complex subunit 2C OS=Homo sapiens OX=9606 GN=WASHC2C PE=1 SV=5
8	A0A0A0MT65	1.18e-165	497	279	0.201	0.950	A0A0A0MT65_HUMAN WASH complex subunit 2C (Fragment) OS=Homo sapiens OX=9606 GN=WASHC2C PE=1 SV=1
9	Q552E2	2.10e-30	133	1479	0.052	0.047	WASC2_DICDI WASH complex subunit 2 OS=Dictyostelium discoideum OX=44689 GN=washc2 PE=1 SV=1
10	Q585V1	5.59e-08	59.7	713	0.029	0.053	Q585V1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30J2.50 PE=4 SV=1
11	A1ZBW7	2.28e-07	58.2	1469	0.035	0.031	WASC2_DROME WASH complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=FAM21 PE=1 SV=1
12	Q0P484	0.036	40.4	305	0.032	0.138	Q0P484_DANRE CapZ-interacting protein OS=Danio rerio OX=7955 GN=zgc:153303 PE=2 SV=1
13	Q64FF8	0.30	37.7	404	0.023	0.077	Q64FF8_DANRE Aryl hydrocarbon receptor nuclear translocator isoform b OS=Danio rerio OX=7955 GN=zgc:136664 PE=2 SV=1
14	Q64FF9	1.2	35.8	503	0.023	0.062	Q64FF9_DANRE Aryl hydrocarbon receptor nuclear translocator OS=Danio rerio OX=7955 GN=zgc:136664 PE=2 SV=1
15	Q1JPT1	1.7	35.0	440	0.023	0.070	Q1JPT1_DANRE Aryl hydrocarbon receptor nuclear translocator OS=Danio rerio OX=7955 GN=zgc:136664 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15255 CAP-ZIP_m	9.4e-50	180.0	WASH complex subunit CAP-Z interacting, central region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363482

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000318016	0.999	WASH complex subunit 5
2	9606.ENSP00000240079	0.998	WASH complex subunit 3
3	9606.ENSP00000484713	0.998	WASH complex subunit 4
4	9606.ENSP00000485627	0.997	WASH complex subunit 1
5	9606.ENSP00000401010	0.956	F-actin-capping protein subunit beta
6	9606.ENSP00000263168	0.950	F-actin-capping protein subunit alpha-1
7	9606.ENSP00000238256	0.923	FK506-binding protein 15
8	9606.ENSP00000299138	0.888	Vacuolar protein sorting-associated protein 35
9	9606.ENSP00000282633	0.831	WASH complex subunit 2A
10	9606.ENSP00000317542	0.809	Putative WAS protein family homolog 4
11	9606.ENSP00000365477	0.797	Coiled-coil domain-containing protein 93
12	9606.ENSP00000339484	0.783	Zinc finger AN1-type containing 4
13	9606.ENSP00000362480	0.743	Vacuolar protein sorting-associated protein 26A
14	9606.ENSP00000480853	0.735	Vacuolar protein sorting-associated protein 29
15	9606.ENSP00000349437	0.730	Cation-independent mannose-6-phosphate receptor
16	9606.ENSP00000334958	0.725	Capping protein, Arp2/3 and myosin-I linker protein 2
17	9606.ENSP00000485442	0.720	Acts as a nucleation-promoting factor at the surface of endosomes, where it recruits and activates the Arp2/3 complex to induce actin polymerization, playing a key role in the fission of tubules that serve as transport intermediates during endosome sorting. Involved in endocytic trafficking of EGF. Its assembly in the WASH core complex seems to inhibit its NPF activity and via WASHC2 is required for its membrane targeting. Involved in transferrin receptor recycling. Regulates the trafficking of endosomal alpha5beta1 integrin to the plasma membrane and involved in invasive cell migratio [...]
18	9606.ENSP00000365891	0.719	Wiskott-Aldrich syndrome protein
19	9606.ENSP00000354947	0.710	F-actin-capping protein subunit alpha-2
20	9606.ENSP00000365401	0.678	Coiled-coil domain-containing protein 22

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0035091	0.980	phosphatidylinositol binding
GO:1905394	0.950	retromer complex binding
GO:0080025	0.944	phosphatidylinositol-3,5-bisphosphate binding
GO:0043325	0.943	phosphatidylinositol-3,4-bisphosphate binding
GO:0005547	0.942	phosphatidylinositol-3,4,5-trisphosphate binding
GO:0010314	0.941	phosphatidylinositol-5-phosphate binding
GO:0005546	0.941	phosphatidylinositol-4,5-bisphosphate binding
GO:0070273	0.939	phosphatidylinositol-4-phosphate binding
GO:0032266	0.939	phosphatidylinositol-3-phosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0051179	0.981	localization
GO:0051641	0.967	cellular localization
GO:0050789	0.949	regulation of biological process
GO:0006810	0.933	transport
GO:0050794	0.925	regulation of cellular process
GO:0051649	0.922	establishment of localization in cell
GO:0046907	0.900	intracellular transport
GO:0033036	0.888	macromolecule localization
GO:0016043	0.866	cellular component organization
GO:0016197	0.862	endosomal transport
GO:0008104	0.860	protein localization
GO:0048522	0.786	positive regulation of cellular process
GO:0051668	0.779	localization within membrane
GO:0016482	0.759	cytosolic transport
GO:0032456	0.744	endocytic recycling
GO:0042147	0.743	retrograde transport, endosome to Golgi
GO:0051128	0.696	regulation of cellular component organization
GO:0051130	0.687	positive regulation of cellular component organization
GO:0033365	0.643	protein localization to organelle
GO:0048523	0.635	negative regulation of cellular process
GO:0044087	0.331	regulation of cellular component biogenesis
GO:0033043	0.321	regulation of organelle organization
GO:0110053	0.303	regulation of actin filament organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005730	0.999	nucleolus
GO:0097708	0.509	intracellular vesicle
GO:0016020	0.467	membrane
GO:0032991	0.372	protein-containing complex
GO:0012505	0.354	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]