StarFunc result for job id Q9Y4E5

User Input

>input (1061 residues)
MGDPGSEIIESVPPAGPEASESTTDENEDDIQFVSEGPLRPVLEYIDLVSSDDEEPSTSY
TDENIKRKDHIDYQKDKVALTLARLARHVEVEKQQKEEKNRAFREKIDFQHAHGLQELEF
IRGHSDTEAARLCVDQWLKMPGLKTGTINCGTKSSFRRGGHTWVSGKPILCPIMHCNKEF
DNGHLLLGHLKRFDHSPCDPTITLHGPFFSSFACVVCYKKFVTQQQYRDHLFDKEATDDG
HNNNLLPQIIQCFACPNCFLLFSRKEECSKHMSGKNHFHQSFKLGDNKGIAHPISFPSFA
KKLLISLCKDVPFQVKCVACHKTLRSHMELTAHFRVHCRNAGPVAVAEKSITQVAEKFIL
RGYCPDCNQVFVDETSTQNHKQNSGHKVRVINSVEESVLLYCHSSEGNKDPSSDLHLLLD
QSKFSSLKRTMSIKESSSLECIAIPKKKMNLKDKSHEGVACVQKEKSVVKTWFCECNQRF
PSEDAVEKHVFSANTMGYKCVVCGKVCDDSGVIRLHMSRIHGGAHLNNFLFWCRTCKKEL
TRKDTIMAHVTEFHNGHRYFYEMDEVEGETLPSSSTTLDNLTANKPSSAITVIDHSPANS
SPRGKWQCRICEDMFDSQEYVKQHCMSLASHKFHRYSCAHCRKPFHKIETLYRHCQDEHD
NEIKIKYFCGLCDLIFNVEEAFLSHYEEHHSIDYVFVSEKTETSIKTEDDFPVIETSNQL
TCGCRESYICKVNRKEDYSRCLQIMLDKGKLWFRCSLCSATAQNLTDMNTHIHQVHKEKS
DEEEQQYVIKCGTCTKAFHDPESAQQHFHRKHCFLQKPSVAHFGSEKSNLYKFTASASHT
ERKLKQAINYSKSLDMEKGVENDLSYQNIEEEIVELPDLDYLRTMTHIVFVDFDNWSNFF
GHLPGHLNQGTFIWGFQGGNTNWKPPLNCKIYNYLNRIGCFFLHPRCSKRKDAADFAICM
HAGRLDEQLPKQIPFTILSGDQGFLELENQFKKTQRPAHILNPHHLEGDMMCALLNSISD
TTKECDSDDNMGAKNTSIGEEFISTEDVELEEAIRRSLEEM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y4E5	1.000	1.000	0.000	1061	1.000	1.000	Q9Y4E5.pdb.gz	ZN451_HUMAN E3 SUMO-protein ligase ZNF451 OS=Homo sapiens OX=9606 GN=ZNF451 PE=1 SV=2
2	AFDB:A0A0B4K7S6	0.057	0.040	1.291E-8	1965	0.123	0.066	A0A0B4K7S6.pdb.gz	A0A0B4K7S6_DROME Molting defective, isoform D OS=Drosophila melanogaster OX=7227 GN=mld PE=4 SV=1
3	AFDB:Q8N393	0.061	0.078	2.123E-6	782	0.124	0.169	Q8N393.pdb.gz	ZN786_HUMAN Zinc finger protein 786 OS=Homo sapiens OX=9606 GN=ZNF786 PE=1 SV=2
4	AFDB:P28166	0.052	0.053	2.243E-6	1054	0.123	0.124	P28166.pdb.gz	ZFH1_DROME Zinc finger protein 1 OS=Drosophila melanogaster OX=7227 GN=zfh1 PE=1 SV=2
5	AFDB:O44122	0.048	0.060	5.396E-6	777	0.118	0.161	O44122.pdb.gz	O44122_DROME Zinc finger 30C OS=Drosophila melanogaster OX=7227 GN=zf30C PE=2 SV=1
6	AFDB:Q9ULD5	0.062	0.070	9.868E-6	831	0.111	0.142	Q9ULD5.pdb.gz	ZN777_HUMAN Zinc finger protein 777 OS=Homo sapiens OX=9606 GN=ZNF777 PE=1 SV=3
7	AFDB:F4J311	0.055	0.079	1.708E-5	650	0.091	0.149	F4J311.pdb.gz	F4J311_ARATH Zinc finger (C2H2 type) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g29340 PE=4 SV=1
8	AFDB:P15619	0.057	0.067	3.890E-5	869	0.067	0.082	P15619.pdb.gz	SRYC_DROME Serendipity locus protein H-1 OS=Drosophila melanogaster OX=7227 GN=wdn PE=1 SV=2
9	AFDB:Q8SXL3	0.045	0.068	8.858E-5	548	0.058	0.113	Q8SXL3.pdb.gz	Q8SXL3_DROME RE10012p OS=Drosophila melanogaster OX=7227 GN=wor PE=2 SV=1
10	AFDB:Q9NSC2	0.064	0.054	1.808E-4	1324	0.122	0.097	Q9NSC2.pdb.gz	SALL1_HUMAN Sal-like protein 1 OS=Homo sapiens OX=9606 GN=SALL1 PE=1 SV=2
11	PDB:7zzuB	0.072	0.170	8.348E-2	371	0.018	0.051	7zzuB.pdb.gz	Fragment-Based Discovery of a Novel, Brain Penetrant, Orally Active HDAC2 Inhibitor.
12	PDB:2f1kA	0.060	0.157	1.295E-1	279	0.020	0.075	2f1kA.pdb.gz	Biochemical Characterization and Crystal Structure of Synechocystis Arogenate Dehydrogenase Provide Insights into Catalytic Reaction
13	PDB:2r8xH	0.069	0.251	1.368E-1	183	0.013	0.077	2r8xH.pdb.gz
14	PDB:4bb9A	0.056	0.084	1.368E-1	596	0.017	0.030	4bb9A.pdb.gz	Crystal Structure of Glucokinase Regulatory Protein.
15	PDB:5a3jC	0.075	0.189	1.368E-1	327	0.013	0.043	5a3jC.pdb.gz	Crystal Structure of the Chloroplastic Oxoene Reductase ceQORH from Arabidopsis thaliana.
16	PDB:6k0kC	0.068	0.129	1.526E-1	397	0.022	0.058	6k0kC.pdb.gz	Crystal structure of Escherichia coli pyruvate kinase II
17	PDB:1k92A	0.074	0.145	1.901E-1	444	0.017	0.041	1k92A.pdb.gz
18	PDB:7d5s5K	0.078	0.337	2.122E-1	175	0.019	0.114	7d5s5K.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
19	PDB:7pxeA	0.079	0.092	2.642E-1	885	0.020	0.024	7pxeA.pdb.gz	Small molecule modulation of the Drosophila Slo channel elucidated by cryo-EM.
20	PDB:3rqsB	0.087	0.234	2.791E-1	316	0.014	0.047	3rqsB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y4E5	0.0	2219	1061	1.000	1.000	ZN451_HUMAN E3 SUMO-protein ligase ZNF451 OS=Homo sapiens OX=9606 GN=ZNF451 PE=1 SV=2
2	Q9HCI6	1.82e-26	119	787	0.052	0.070	K1586_HUMAN E3 SUMO-protein ligase KIAA1586 OS=Homo sapiens OX=9606 GN=KIAA1586 PE=1 SV=2
3	Q5T427	2.93e-08	59.7	392	0.070	0.189	Q5T427_HUMAN Zinc finger protein 438 OS=Homo sapiens OX=9606 GN=ZNF438 PE=1 SV=1
4	Q7Z4V0	3.00e-08	60.5	828	0.059	0.076	ZN438_HUMAN Zinc finger protein 438 OS=Homo sapiens OX=9606 GN=ZNF438 PE=1 SV=1
5	Q8BHZ4	1.20e-07	58.5	1262	0.037	0.031	ZN592_MOUSE Zinc finger protein 592 OS=Mus musculus OX=10090 GN=Znf592 PE=1 SV=3
6	Q9HCX3	5.44e-07	56.2	659	0.059	0.096	ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens OX=9606 GN=ZNF304 PE=1 SV=2
7	Q92610	5.80e-07	56.2	1267	0.035	0.029	ZN592_HUMAN Zinc finger protein 592 OS=Homo sapiens OX=9606 GN=ZNF592 PE=1 SV=2
8	Q9NQV6	2.20e-06	54.3	1147	0.070	0.065	PRD10_HUMAN PR domain zinc finger protein 10 OS=Homo sapiens OX=9606 GN=PRDM10 PE=1 SV=3
9	Q99MD8	9.25e-06	52.0	610	0.067	0.116	MYNN_MOUSE Myoneurin OS=Mus musculus OX=10090 GN=Mynn PE=2 SV=2
10	Q80TS5	1.18e-05	52.0	1292	0.077	0.063	ZN423_MOUSE Zinc finger protein 423 OS=Mus musculus OX=10090 GN=Znf423 PE=1 SV=2
11	Q9NQX1	1.78e-05	51.2	630	0.067	0.113	PRDM5_HUMAN PR domain zinc finger protein 5 OS=Homo sapiens OX=9606 GN=PRDM5 PE=1 SV=2
12	Q9NPC7	4.10e-05	50.1	610	0.062	0.108	MYNN_HUMAN Myoneurin OS=Homo sapiens OX=9606 GN=MYNN PE=1 SV=1
13	F1Q8J8	4.78e-05	49.7	634	0.074	0.125	F1Q8J8_DANRE PR domain zinc finger protein 5 OS=Danio rerio OX=7955 GN=prdm5 PE=4 SV=1
14	O08961	5.24e-05	50.1	1311	0.079	0.064	ZN423_RAT Zinc finger protein 423 OS=Rattus norvegicus OX=10116 GN=Znf423 PE=1 SV=2
15	Q9CXE0	9.89e-05	48.9	599	0.060	0.107	PRDM5_MOUSE PR domain zinc finger protein 5 OS=Mus musculus OX=10090 GN=Prdm5 PE=2 SV=2
16	Q2M1K9	1.11e-04	48.9	1284	0.076	0.063	ZN423_HUMAN Zinc finger protein 423 OS=Homo sapiens OX=9606 GN=ZNF423 PE=1 SV=1
17	F5H7S1	1.44e-04	48.5	1167	0.076	0.069	F5H7S1_HUMAN Zinc finger protein 423 OS=Homo sapiens OX=9606 GN=ZNF423 PE=1 SV=1
18	Q3ZCT1	1.52e-04	47.8	412	0.049	0.126	ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens OX=9606 GN=ZNF260 PE=1 SV=3
19	Q7YTY9	1.96e-04	46.2	214	0.041	0.201	Q7YTY9_DROME GH06338p OS=Drosophila melanogaster OX=7227 GN=CG30431 PE=2 SV=1
20	A1Z9R4	2.32e-04	47.8	1228	0.048	0.042	ZN423_DROME Zinc finger protein 423 homolog OS=Drosophila melanogaster OX=7227 GN=Oaz PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18475 PIN7	0.0077	28.2	PIN domain
2	PF18479 PIN_11	1.4e-61	217.3	PIN like domain
3	PF00096 zf-C2H2	4.4e+02	12.8	Zinc finger, C2H2 type
4	PF12756 zf-C2H2_2	2.1e+02	13.6	C2H2 type zinc-finger (2 copies)
5	PF13894 zf-C2H2_4	1.3e-06	39.7	C2H2-type zinc finger
6	PF12171 zf-C2H2_jaz	2.7e+02	13.3	Zinc-finger double-stranded RNA-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359740

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348056	0.918	SUMO-conjugating enzyme UBC9
2	9606.ENSP00000249636	0.784	E3 SUMO-protein ligase PIAS1
3	9606.ENSP00000347648	0.709	Zinc finger protein 512
4	9606.ENSP00000385632	0.694	High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A
5	9606.ENSP00000266732	0.693	Lamina-associated polypeptide 2, isoform alpha
6	9606.ENSP00000405965	0.691	Small ubiquitin-related modifier 2
7	9606.ENSP00000376077	0.690	Small ubiquitin-related modifier 1
8	9606.ENSP00000348596	0.668	Protein SDA1 homolog
9	9606.ENSP00000446335	0.636	Zinc finger protein 362
10	9606.ENSP00000418944	0.634	Retrotransposon-derived protein PEG10
11	9606.ENSP00000363822	0.626	Androgen receptor
12	9606.ENSP00000359727	0.617	BAG family molecular chaperone regulator 2
13	9606.ENSP00000380157	0.606	Molybdopterin synthase catalytic subunit
14	9606.ENSP00000261340	0.576	C-type lectin domain family 2 member D
15	9606.ENSP00000367440	0.574	Tyrosyl-DNA phosphodiesterase 2
16	9606.ENSP00000363041	0.566	CDGSH iron-sulfur domain-containing protein 1
17	9606.ENSP00000307959	0.555	Dystonin
18	9606.ENSP00000426503	0.555	E3 ubiquitin-protein ligase RNF4
19	9606.ENSP00000303427	0.544	Sister chromatid cohesion protein PDS5 homolog A
20	9606.ENSP00000259939	0.541	E3 ubiquitin-protein ligase RNF144B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140096	1.000	catalytic activity, acting on a protein
GO:0005515	1.000	protein binding
GO:0016740	0.998	transferase activity
GO:0019787	0.993	ubiquitin-like protein transferase activity
GO:0140110	0.959	transcription regulator activity
GO:0019789	0.935	SUMO transferase activity
GO:0003712	0.932	transcription coregulator activity
GO:0061659	0.928	ubiquitin-like protein ligase activity
GO:0061665	0.922	SUMO ligase activity
GO:0140678	0.918	molecular function inhibitor activity
GO:0140416	0.910	transcription regulator inhibitor activity
GO:0003714	0.903	transcription corepressor activity
GO:1901363	0.632	heterocyclic compound binding
GO:0097159	0.632	organic cyclic compound binding
GO:0003676	0.622	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.987	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0050794	0.985	regulation of cellular process
GO:0048523	0.979	negative regulation of cellular process
GO:0006355	0.978	regulation of DNA-templated transcription
GO:0036211	0.971	protein modification process
GO:0009892	0.966	negative regulation of metabolic process
GO:0010605	0.964	negative regulation of macromolecule metabolic process
GO:0051172	0.960	negative regulation of nitrogen compound metabolic process
GO:1902679	0.940	negative regulation of RNA biosynthetic process
GO:0006357	0.939	regulation of transcription by RNA polymerase II
GO:0045892	0.921	negative regulation of DNA-templated transcription
GO:0090092	0.913	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0070647	0.845	protein modification by small protein conjugation or removal
GO:1903844	0.803	regulation of cellular response to transforming growth factor beta stimulus
GO:0017015	0.769	regulation of transforming growth factor beta receptor signaling pathway
GO:0032446	0.767	protein modification by small protein conjugation
GO:0090101	0.757	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0018205	0.750	peptidyl-lysine modification
GO:0009987	0.737	cellular process
GO:2000142	0.701	regulation of DNA-templated transcription initiation
GO:0030512	0.676	negative regulation of transforming growth factor beta receptor signaling pathway
GO:0016925	0.662	protein sumoylation
GO:0060260	0.598	regulation of transcription initiation by RNA polymerase II
GO:0000122	0.385	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.960	nuclear lumen
GO:0005654	0.950	nucleoplasm
GO:0043232	0.676	intracellular non-membrane-bounded organelle
GO:0005737	0.360	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.998	Transferases.

[back to server]