StarFunc result for job id Q9Y4E6

User Input

>input (1490 residues)
MAGNSLVLPIVLWGRKAPTHCISAVLLTDDGATIVTGCHDGQICLWDLSVELQINPRALL
FGHTASITCLSKACASSDKQYIVSASESGEMCLWDVSDGRCIEFTKLACTHTGIQFYQFS
VGNQREGRLLCHGHYPEILVVDATSLEVLYSLVSKISPDWISSMSIIRSHRTQEDTVVAL
SVTGILKVWIVTSEISDMQDTEPIFEEESKPIYCQNCQSISFCAFTQRSLLVVCSKYWRV
FDAGDYSLLCSGPSENGQTWTGGDFVSSDKVIIWTENGQSYIYKLPASCLPASDSFRSDV
GKAVENLIPPVQHILLDRKDKELLICPPVTRFFYGCREYFHKLLIQGDSSGRLNIWNISD
TADKQGSEEGLAMTTSISLQEAFDKLNPCPAGIIDQLSVIPNSNEPLKVTASVYIPAHGR
LVCGREDGSIVIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYPHQVSARY
DQRYLISGGVDFSVIIWDIFSGEMKHIFCVHGGEITQLLVPPENCSARVQHCICSVASDH
SVGLLSLREKKCIMLASRHLFPIQVIKWRPSDDYLVVGCSDGSVYVWQMDTGALDRCVMG
ITAVEILNACDEAVPAAVDSLSHPAVNLKQAMTRRSLAALKNMAHHKLQTLATNLLASEA
SDKGNLPKYSHNSLMVQAIKTNLTDPDIHVLFFDVEALIIQLLTEEASRPNTALISPENL
QKASGSSDKGGSFLTGKRAAVLFQQVKETIKENIKEHLLDDEEEDEEIMRQRREESDPEY
RSSKSKPLTLLEYNLTMDTAKLFMSCLHAWGLNEVLDEVCLDRLGMLKPHCTVSFGLLSR
GGHMSLMLPGYNQPACKLSHGKTEVGRKLPASEGVGKGTYGVSRAVTTQHLLSIISLANT
LMSMTNATFIGDHMKKGPTRPPRPSTPDLSKARGSPPTSSNIVQGQIKQVAAPVVSARSD
ADHSGSDPPSAPALHTCFLVNEGWSQLAAMHCVMLPDLLGLDKFRPPLLEMLARRWQDRC
LEVREAAQALLLAELRRIEQAGRKEAIDAWAPYLPQYIDHVISPGVTSEAAQTITTAPDA
SGPEAKVQEEEHDLVDDDITTGCLSSVPQMKKISTSYEERRKQATAIVLLGVIGAEFGAE
IEPPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTFLLLQPPSPKLPPHSTIRRT
AIDLIGRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITMGLPLSPAADSARSARHALS
LIATARPPAFITTIAKEVHRHTALAANTQSQQNMHTTTLARAKGEILRVIEILIEKMPTD
VVDLLVEVMDIIMYCLEGSLVKKKGLQECFPAICRFYMVSYYERNHRIAVGARHGSVALY
DIRTGKCQTIHGHKGPITAVAFAPDGRYLATYSNTDSHISFWQMNTSLLGSIGMLNSAPQ
LRCIKTYQVPPVQPASPGSHNALKLARLIWTSNRNVILMAHDGKEHRFMV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q920I9	0.952	0.953	0.000	1489	0.949	0.950	Q920I9.pdb.gz	WDR7_MOUSE WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Wdr7 PE=1 SV=3
2	AFDB:Q9W543	0.806	0.789	0.000	1525	0.426	0.416	Q9W543.pdb.gz	Q9W543_DROME Rabconnectin-3B, isoform A OS=Drosophila melanogaster OX=7227 GN=Rbcn-3B PE=1 SV=1
3	AFDB:A2RRE0	0.344	0.600	2.438E-77	815	0.506	0.925	A2RRE0.pdb.gz	A2RRE0_HUMAN WDR7 protein OS=Homo sapiens OX=9606 GN=WDR7 PE=1 SV=1
4	AFDB:Q3MJ13	0.473	0.631	3.193E-64	1102	0.244	0.330	Q3MJ13.pdb.gz	WDR72_HUMAN WD repeat-containing protein 72 OS=Homo sapiens OX=9606 GN=WDR72 PE=2 SV=2
5	AFDB:D3YYM4	0.451	0.593	2.922E-62	1114	0.240	0.320	D3YYM4.pdb.gz	WDR72_MOUSE WD repeat-containing protein 72 OS=Mus musculus OX=10090 GN=Wdr72 PE=1 SV=1
6	PDB:7mq8LR	0.154	0.283	3.807E-17	773	0.054	0.103	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
7	AFDB:O88879	0.150	0.178	5.241E-17	1249	0.054	0.064	O88879.pdb.gz	APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus OX=10090 GN=Apaf1 PE=1 SV=3
8	AFDB:Q06078	0.141	0.209	5.241E-17	939	0.079	0.126	Q06078.pdb.gz	UTP21_YEAST U3 small nucleolar RNA-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTP21 PE=1 SV=1
9	PDB:7mq8LT	0.146	0.233	5.698E-17	869	0.048	0.083	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
10	AFDB:Q8NI36	0.140	0.206	8.502E-17	951	0.049	0.077	Q8NI36.pdb.gz	WDR36_HUMAN WD repeat-containing protein 36 OS=Homo sapiens OX=9606 GN=WDR36 PE=1 SV=1
11	AFDB:Q05946	0.180	0.311	1.495E-16	817	0.057	0.104	Q05946.pdb.gz	UTP13_YEAST U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTP13 PE=1 SV=1
12	AFDB:Q3TAQ9	0.141	0.220	1.621E-16	899	0.050	0.083	Q3TAQ9.pdb.gz	Q3TAQ9_MOUSE WD repeat domain 36 OS=Mus musculus OX=10090 GN=Wdr36 PE=1 SV=1
13	PDB:6lqsBE	0.140	0.234	7.495E-15	823	0.058	0.106	6lqsBE.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
14	PDB:7ajtUM	0.171	0.315	8.807E-15	762	0.055	0.108	7ajtUM.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:7mqaLQ	0.102	0.174	9.939E-15	830	0.065	0.117	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7d4iBE	0.139	0.219	1.266E-14	890	0.056	0.094	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
17	PDB:7ajuUL	0.221	0.362	1.488E-14	779	0.057	0.109	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
18	PDB:7rroe	0.149	0.340	2.226E-14	610	0.050	0.121	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
19	PDB:7d5sBE	0.141	0.223	5.860E-14	865	0.055	0.095	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
20	PDB:5wyjBE	0.224	0.395	7.465E-14	753	0.045	0.089	5wyjBE.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RRE0	0.0	1549	815	0.504	0.921	A2RRE0_HUMAN WDR7 protein OS=Homo sapiens OX=9606 GN=WDR7 PE=1 SV=1
2	O46092	0.0	779	1471	0.283	0.286	O46092_DROME EG:86E4.3 protein OS=Drosophila melanogaster OX=7227 GN=Rbcn-3B PE=4 SV=1
3	Q2XXU2	0.0	842	1505	0.302	0.299	Q2XXU2_DROME CG17766 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Rbcn-3B PE=4 SV=1
4	Q3MJ13	0.0	607	1102	0.234	0.317	WDR72_HUMAN WD repeat-containing protein 72 OS=Homo sapiens OX=9606 GN=WDR72 PE=2 SV=2
5	Q920I9	0.0	2876	1489	0.950	0.951	WDR7_MOUSE WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Wdr7 PE=1 SV=3
6	Q9ERH3	0.0	2855	1488	0.946	0.947	WDR7_RAT WD repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Wdr7 PE=1 SV=1
7	Q9W543	0.0	851	1525	0.305	0.298	Q9W543_DROME Rabconnectin-3B, isoform A OS=Drosophila melanogaster OX=7227 GN=Rbcn-3B PE=1 SV=1
8	D3YYM4	2.71e-179	567	1114	0.217	0.290	WDR72_MOUSE WD repeat-containing protein 72 OS=Mus musculus OX=10090 GN=Wdr72 PE=1 SV=1
9	Q960M9	5.35e-102	332	343	0.113	0.490	Q960M9_DROME LD43670p OS=Drosophila melanogaster OX=7227 GN=Rbcn-3B PE=2 SV=1
10	D6QUQ2	4.25e-08	60.1	463	0.028	0.091	D6QUQ2_9CNID Poc1 OS=Clytia hemisphaerica OX=252671 PE=2 SV=1
11	Q38BV9	1.65e-07	58.5	780	0.023	0.045	Q38BV9_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4780 PE=4 SV=1
12	Q8JZX3	1.97e-07	57.8	405	0.026	0.094	POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus OX=10090 GN=Poc1a PE=2 SV=2
13	O22826	2.50e-07	57.0	343	0.021	0.090	O22826_ARATH At2g43770 OS=Arabidopsis thaliana OX=3702 GN=At2g43770 PE=1 SV=1
14	Q8NBT0	2.81e-07	57.0	407	0.026	0.093	POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens OX=9606 GN=POC1A PE=1 SV=2
15	Q9NVX2	5.53e-07	56.6	485	0.030	0.091	NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens OX=9606 GN=NLE1 PE=1 SV=4
16	Q8VEJ4	6.98e-07	56.2	485	0.020	0.062	NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus OX=10090 GN=Nle1 PE=1 SV=4
17	Q8C092	1.90e-06	55.1	801	0.019	0.036	TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus OX=10090 GN=Taf5 PE=1 SV=1
18	P90794	2.26e-06	54.7	571	0.040	0.105	DCA11_CAEEL DDB1- and CUL4-associated factor 11 homolog OS=Caenorhabditis elegans OX=6239 GN=wdr-23 PE=3 SV=1
19	A2CEH0	3.87e-06	53.5	490	0.027	0.082	POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio OX=7955 GN=poc1b PE=2 SV=1
20	Q15542	5.10e-06	53.5	800	0.019	0.035	TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens OX=9606 GN=TAF5 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	2.6e-06	38.9	Anaphase-promoting complex subunit 4 WD40 domain
2	PF16529 Ge1_WD40	0.45	21.1	WD40 region of Ge1, enhancer of mRNA-decapping protein
3	PF20426 NBCH_WD40	0.056	23.9	Neurobeachin beta propeller domain
4	PF11715 Nup160	1.5e+02	12.6	Nucleoporin Nup120/160
5	PF00400 WD40	6.8e-18	75.9	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254442

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000441858	0.972	DmX-like protein 2
2	9606.ENSP00000351832	0.835	Rab3 GTPase-activating protein non-catalytic subunit
3	9606.ENSP00000274008	0.802	Spermatogenesis-associated protein 5
4	9606.ENSP00000222256	0.792	Ras-related protein Rab-3A
5	9606.ENSP00000384018	0.773	Nuclear receptor corepressor 2
6	9606.ENSP00000310933	0.769	MAP kinase-activating death domain protein
7	9606.ENSP00000439479	0.734	DmX-like protein 1
8	9606.ENSP00000308695	0.726	Probable C-mannosyltransferase DPY19L1
9	9606.ENSP00000315988	0.726	Probable C-mannosyltransferase DPY19L2
10	9606.ENSP00000354111	0.708	DnaJ homolog subfamily C member 5
11	9606.ENSP00000411418	0.705	Rab3 GTPase-activating protein catalytic subunit
12	9606.ENSP00000322832	0.658	Protein rogdi homolog
13	9606.ENSP00000234396	0.651	V-type proton ATPase subunit B, kidney isoform
14	9606.ENSP00000416429	0.641	Ribosomal protein L32
15	9606.ENSP00000273920	0.637	Enolase-phosphatase E1
16	9606.ENSP00000315743	0.634	Cyclin-G2
17	9606.ENSP00000372326	0.622	Ferrochelatase, mitochondrial
18	9606.ENSP00000333833	0.617	CKLF like MARVEL transmembrane domain containing 4
19	9606.ENSP00000351596	0.617	Tetratricopeptide repeat protein 37
20	9606.ENSP00000318298	0.588	Putative nucleotidyltransferase FAM46A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0048856	0.986	anatomical structure development
GO:0002244	0.848	hematopoietic progenitor cell differentiation
GO:0065007	0.541	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0031982	0.996	vesicle
GO:0031410	0.985	cytoplasmic vesicle
GO:0016020	0.897	membrane
GO:0099503	0.797	secretory vesicle
GO:0030054	0.763	cell junction
GO:0098793	0.750	presynapse
GO:0030133	0.735	transport vesicle
GO:0008021	0.708	synaptic vesicle
GO:0005829	0.358	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]