StarFunc result for job id Q9Y4F1

User Input

>input (1045 residues)
MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPQRA
PGKVLLDAVCNHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVVVKFVVKFF
PPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDFDEALDREHL
AKNKYIPQQDALEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGIRLHPAKDREGTKI
NLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDANSAYQDTLEFLMASRD
FCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEGGHKKVQ
FERKHSKIHSIRSLASQPTELNSEVLEQSQQSTSLTFGEGAESPGGQSCRRGKEPKVSAG
EPGSHPSPAPRRSPAGNKQADGAASAPTEEEEEVVKDRTQQSKPQPPQPSTGSLTGSPHL
SELSVNSQGGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDEGRRKRFPTDK
AYFIAKEVSTTERTYLKDLEVITSWFQSTVSKEDAMPEALKSLIFPNFEPLHKFHTNFLK
EIEQRLALWEGRSNAQIRDYQRIGDVMLKNIQGMKHLAAHLWKHSEALEALENGIKSSRR
LENFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQVLERLCKHHPPSHADFRDCRAALAEI
TEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVVPGREFIRLGSLSKLSGKGLQQRMFF
LFNDVLLYTSRGLTASNQFKVHGQLPLYGMTIEESEDEWGVPHCLTLRGQRQSIIVAASS
RSEMEKWVEDIQMAIDLAEKSSSPAPEFLASSPPDNKSPDEATAADQESEDDLSASRTSL
ERQAPHRGNTMVHVCWHRNTSVSMVDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNFC
LFFYKSHQDNHPLASLPLLGYSLTIPSESENIQKDYVFKLHFKSHVYYFRAESEYTFERW
MEVIRSATSSASRPHVLSHKESLVY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LYQ8	0.811	0.808	0.000	1049	0.924	0.921	F1LYQ8.pdb.gz	FARP1_RAT FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Farp1 PE=1 SV=2
2	AFDB:O94887	0.723	0.717	4.951E-104	1054	0.551	0.546	O94887.pdb.gz	FARP2_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2 PE=1 SV=3
3	AFDB:B8JHS0	0.320	0.411	8.861E-48	811	0.297	0.382	B8JHS0.pdb.gz
4	AFDB:Q6ZUT3	0.311	0.454	4.239E-37	714	0.223	0.326	Q6ZUT3.pdb.gz	FRMD7_HUMAN FERM domain-containing protein 7 OS=Homo sapiens OX=9606 GN=FRMD7 PE=1 SV=1
5	AFDB:A2AD83	0.311	0.461	6.198E-36	703	0.222	0.330	A2AD83.pdb.gz	FRMD7_MOUSE FERM domain-containing protein 7 OS=Mus musculus OX=10090 GN=Frmd7 PE=1 SV=1
6	AFDB:A0A2R8Y5B3	0.303	0.382	4.957E-30	824	0.180	0.228	A0A2R8Y5B3.pdb.gz	A0A2R8Y5B3_HUMAN Erythrocyte membrane protein band 4.1 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
7	AFDB:E9PHY5	0.306	0.341	6.483E-30	935	0.181	0.202	E9PHY5.pdb.gz	E9PHY5_HUMAN Erythrocyte membrane protein band 4.1 like 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
8	AFDB:A3E0T0	0.304	0.364	4.239E-29	870	0.166	0.199	A3E0T0.pdb.gz	A3E0T0_RAT Erythrocyte protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=2 SV=1
9	AFDB:A0A3B3IU06	0.304	0.392	6.062E-29	807	0.177	0.229	A0A3B3IU06.pdb.gz	A0A3B3IU06_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
10	AFDB:O43491	0.304	0.316	1.084E-28	1005	0.162	0.168	O43491.pdb.gz	E41L2_HUMAN Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
11	PDB:4rm8A	0.251	0.681	4.209E-17	368	0.080	0.228	4rm8A.pdb.gz
12	PDB:7rx9A	0.187	0.413	1.760E-12	432	0.068	0.164	7rx9A.pdb.gz
13	PDB:4mt6A	0.219	0.490	1.505E-11	389	0.063	0.170	4mt6A.pdb.gz
14	PDB:4gouA	0.224	0.415	8.051E-8	507	0.042	0.087	4gouA.pdb.gz
15	PDB:3ljuX	0.088	0.236	2.251E-7	373	0.043	0.121	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
16	PDB:7c3mA	0.209	0.363	4.815E-5	577	0.044	0.080	7c3mA.pdb.gz
17	PDB:5yqrA	0.096	0.335	1.925E-4	268	0.027	0.104	5yqrA.pdb.gz
18	PDB:6bbpA	0.084	0.165	2.753E-4	520	0.026	0.052	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
19	PDB:4mk0A	0.096	0.154	7.363E-4	631	0.029	0.048	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
20	PDB:3pvuA	0.090	0.149	1.053E-3	609	0.030	0.051	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QIC8	0.0	1428	1025	0.700	0.714	E9QIC8_DANRE FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived) OS=Danio rerio OX=7955 GN=farp1 PE=1 SV=1
2	F1LYQ8	0.0	1961	1049	0.922	0.918	FARP1_RAT FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Farp1 PE=1 SV=2
3	O94887	0.0	1130	1054	0.555	0.550	FARP2_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2 PE=1 SV=3
4	Q91VS8	0.0	1136	1065	0.538	0.528	FARP2_MOUSE FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Farp2 PE=1 SV=2
5	Q9Y4F1	0.0	2171	1045	1.000	1.000	FARP1_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FARP1 PE=1 SV=1
6	Q6ZUT3	5.65e-139	436	714	0.212	0.311	FRMD7_HUMAN FERM domain-containing protein 7 OS=Homo sapiens OX=9606 GN=FRMD7 PE=1 SV=1
7	A2AD83	2.25e-134	424	703	0.201	0.299	FRMD7_MOUSE FERM domain-containing protein 7 OS=Mus musculus OX=10090 GN=Frmd7 PE=1 SV=1
8	O17905	1.27e-95	330	1091	0.158	0.151	O17905_CAEEL Moesin/ezrin/radixin homolog 1 OS=Caenorhabditis elegans OX=6239 GN=frm-3 PE=1 SV=2
9	X6R7S7	8.61e-86	291	594	0.147	0.259	X6R7S7_HUMAN FERM domain containing 7 OS=Homo sapiens OX=9606 GN=FRMD7 PE=4 SV=1
10	A8K968	4.79e-79	276	756	0.144	0.200	A8K968_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
11	A0A8I5ZZJ7	9.31e-79	277	835	0.144	0.180	A0A8I5ZZJ7_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=1 SV=1
12	A0A8I5ZVK0	1.65e-78	278	888	0.143	0.168	A0A8I5ZVK0_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=1 SV=1
13	Q9WV92	1.74e-78	278	929	0.146	0.165	E41L3_MOUSE Band 4.1-like protein 3 OS=Mus musculus OX=10090 GN=Epb41l3 PE=1 SV=1
14	O70318	1.77e-78	280	988	0.144	0.153	E41L2_MOUSE Band 4.1-like protein 2 OS=Mus musculus OX=10090 GN=Epb41l2 PE=1 SV=2
15	E9PII3	1.91e-78	273	706	0.142	0.210	E9PII3_HUMAN Erythrocyte membrane protein band 4.1 like 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
16	A3E0T0	2.50e-78	277	870	0.143	0.171	A3E0T0_RAT Erythrocyte protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=2 SV=1
17	F7FPP7	3.27e-78	277	911	0.143	0.164	F7FPP7_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=1 SV=1
18	A0A0G2K1Q9	3.33e-78	278	943	0.143	0.158	A0A0G2K1Q9_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=4 SV=2
19	A0A0A0MRA8	3.81e-78	277	918	0.145	0.166	A0A0A0MRA8_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
20	A0A8I6AUN0	4.74e-78	276	902	0.143	0.165	A0A8I6AUN0_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08736 FA	3.2e-12	57.6	FERM adjacent (FA)
2	PF09380 FERM_C	1.5e-21	87.9	FERM C-terminal PH-like domain
3	PF00373 FERM_M	4.1e-10	51.4	FERM central domain
4	PF09379 FERM_N	4.1e-15	66.7	FERM N-terminal domain
5	PF16453 IQ_SEC7_PH	0.012	26.9	PH domain
6	PF00169 PH	1.9e-22	91.1	PH domain
7	PF15413 PH_11	2.6e+02	13.5	Pleckstrin homology domain
8	PF16652 PH_13	0.0072	27.7	Pleckstrin homology domain
9	PF08458 PH_2	3.3e+02	13.0	Plant pleckstrin homology-like region
10	PF20399 PH_20	74	14.9	PH domain
11	PF15410 PH_9	1.3e+02	14.2	Pleckstrin homology domain
12	PF00621 RhoGEF	2.7e-31	120.7	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000010178

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000038312	0.825	DDB1 and CUL4 associated factor 12-like 2
2	9598.ENSPTRP00000038271	0.817	Ring finger protein 113A
3	9598.ENSPTRP00000042051	0.800	Uncharacterized protein
4	9598.ENSPTRP00000059933	0.788	Uncharacterized protein
5	9598.ENSPTRP00000038270	0.758	NADH dehydrogenase (Ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
6	9598.ENSPTRP00000007397	0.701	Cell adhesion molecule 1
7	9598.ENSPTRP00000016696	0.694	Uncharacterized protein
8	9598.ENSPTRP00000023956	0.694	Uncharacterized protein
9	9598.ENSPTRP00000038898	0.671	DDB1 and CUL4 associated factor 12-like 1
10	9598.ENSPTRP00000025759	0.669	Ras homolog family member A
11	9598.ENSPTRP00000004113	0.617	Neuropilin 1
12	9598.ENSPTRP00000051187	0.592	Activated leukocyte cell adhesion molecule
13	9598.ENSPTRP00000034861	0.568	Uncharacterized protein
14	9598.ENSPTRP00000033105	0.560	Uncharacterized protein
15	9598.ENSPTRP00000034713	0.544	Pan troglodytes syndecan binding protein (syntenin) (SDCBP), mRNA
16	9598.ENSPTRP00000059182	0.544	Afadin, adherens junction formation factor
17	9598.ENSPTRP00000056746	0.524	Uncharacterized protein
18	9598.ENSPTRP00000021948	0.523	Uncharacterized protein
19	9598.ENSPTRP00000001916	0.514	Ras homolog gene family, member C
20	9598.ENSPTRP00000012138	0.510	Protogenin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0019899	0.639	enzyme binding
GO:0031267	0.610	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0065007	0.986	biological regulation
GO:0050794	0.982	regulation of cellular process
GO:0048856	0.890	anatomical structure development
GO:0032501	0.847	multicellular organismal process
GO:0007154	0.834	cell communication
GO:0016043	0.832	cellular component organization
GO:0023052	0.830	signaling
GO:0007275	0.826	multicellular organism development
GO:0048731	0.789	system development
GO:0048468	0.786	cell development
GO:0007399	0.652	nervous system development
GO:0048666	0.575	neuron development
GO:0050896	0.535	response to stimulus
GO:0051128	0.370	regulation of cellular component organization
GO:0051716	0.360	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043226	0.966	organelle
GO:0005886	0.965	plasma membrane
GO:0043229	0.941	intracellular organelle
GO:0043228	0.827	non-membrane-bounded organelle
GO:0043232	0.786	intracellular non-membrane-bounded organelle
GO:0030054	0.758	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]