StarFunc result for job id Q9Y4F3

User Input

>input (1742 residues)
MMEGNGTENSCSRTRGWLQQDNDAKPWLWKFSNCFSRPEQTLPHSPQTKEYMENKKVAVE
LKDVPSPLHAGSKLFPAVPLPDIRSLQQPKIQLSSVPKVSCCAHCPNEPSTSPMRFGGGG
GGSGGTSSLIHPGALLDSQSTRTITCQVGSGFAFQSASSLQNASARNNLAGIASDFPSMC
LESNLSSCKHLPCCGKLHFQSCHGNVHKLHQFPSLQGCTSAGYFPCSDFTSGAPGHLEEH
ISQSELTPHLCTNSLHLNVVPPVCLKGSLYCEDCLNKPARNSIIDAAKVWPNIPPPNTQP
APLAVPLCNGCGTKGTGKETTLLLATSLGKAASKFGSPEVAVAGQVLENLPPIGVFWDIE
NCSVPSGRSATAVVQRIREKFFKGHREAEFICVCDISKENKEVIQELNNCQVTVAHINAT
AKNAADDKLRQSLRRFANTHTAPATVVLVSTDVNFALELSDLRHRHGFHIILVHKNQASE
ALLHHANELIRFEEFISDLPPRLPLKMPQCHTLLYVYNLPANKDGKSVSNRLRRLSDNCG
GKVLSITGCSAILRFINQDSAERAQKRMENEDVFGNRIIVSFTPKNRELCETKSSNAIAD
KVKSPKKLKNPKLCLIKDASEQSSSAKATPGKGSQANSGSATKNTNVKSLQELCRMESKT
GHRNSEHQQGHLRLVVPTHGNSSAAVSTPKNSGVAEPVYKTSQKKENLSARSVTSSPVEK
KDKEETVFQVSYPSAFSKLVASRQVSPLLASQSWSSRSMSPNLLNRASPLAFNIANSSSE
ADCPDPFANGADVQVSNIDYRLSRKELQQLLQEAFARHGKVKSVELSPHTDYQLKAVVQM
ENLQDAIGAVNSLHRYKIGSKKILVSLATGAASKSLSLLSAETMSVLQDAPACCLPLFKF
TDIYEKKFGHKLNVSDLYKLTDTVAIREQGNGRLVCLLPSSQARQSPLGSSQSHDGSSTN
CSPIIFEELEYHEPVCRQHCSNKDFSEHEFDPDSYKIPFVILSLKTFAPQVHSLLQTHEG
TVPLLSFPDCYIAEFGDLEVVQENQGGVPLEHFITCVPGVNIATAQNGIKVVKWIHNKPP
PPNTDPWLLRSKSPVGNPQLIQFSREVIDLLKSQPSCVIPISHFIPSYHHHFAKQCRVSD
YGYSKLIELLEAVPHVLQILGMGSKRLLTLTHRAQVKRFTQDLLKLLKSQASKQVIVREF
SQAYHWCFSKDWDVTEYGVCELIDIVSEIPDTTICLSQQDNEMVICIPKRERTQDEIERT
KQFSKDVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLAYYGFTKLLELFEAIPDTLQVL
ECGEEKILTLTEVERFKALAAQFVKLLRSQKDNCLMMTDLLTEYAKTFGYTFRLQDYDVS
SISALTQKLCHVVKVADIESGRQIQLINRKSLRSLTAQLLVLLMSWEGTTHLSVEELKRH
YESTHNTPLNPCEYGFMTLTELLKSLPYLVEVFTNDKMEECVKLTSLYLFAKNVRSLLHT
YHYQQIFLHEFSMAYTKYVGETLQPKTYGHSSVEELLGAIPQVVWIKGHGHKRIVVLKND
MKSRLSSLSLSPANHENQPSEGERILEVPESHTASELKLGADGSGPSHTEQELLRLTDDS
PVDLLCAPVPSCLPSPQLRPDPVILQSADLIQFEERPQEPSEIMILNQEEKMEIPIPGKS
KTLTSDSSSSCISAAVPVPPCPSSETSESLLSKDPVESPAKKQPKNRVKLAANFSLAPIT
KL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BJ34	0.686	0.690	0.000	1730	0.858	0.864	Q8BJ34.pdb.gz	MARF1_MOUSE Meiosis regulator and mRNA stability factor 1 OS=Mus musculus OX=10090 GN=Marf1 PE=1 SV=3
2	AFDB:Q9Y4F3	0.999	0.999	0.000	1742	1.000	1.000	Q9Y4F3.pdb.gz	MARF1_HUMAN Meiosis regulator and mRNA stability factor 1 OS=Homo sapiens OX=9606 GN=MARF1 PE=1 SV=6
3	AFDB:Q96EV2	0.046	0.063	3.873E-5	1170	0.074	0.110	Q96EV2.pdb.gz	RBM33_HUMAN RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33 PE=1 SV=3
4	AFDB:F1LV37	0.053	0.051	6.345E-5	1818	0.083	0.080	F1LV37.pdb.gz	F1LV37_RAT Trinucleotide repeat containing adaptor 6B OS=Rattus norvegicus OX=10116 GN=Tnrc6b PE=1 SV=3
5	AFDB:Q8SY33	0.050	0.061	8.122E-5	1384	0.083	0.104	Q8SY33.pdb.gz	GAWKY_DROME Protein Gawky OS=Drosophila melanogaster OX=7227 GN=gw PE=1 SV=1
6	AFDB:P78332	0.056	0.079	1.040E-4	1123	0.071	0.110	P78332.pdb.gz	RBM6_HUMAN RNA-binding protein 6 OS=Homo sapiens OX=9606 GN=RBM6 PE=1 SV=5
7	AFDB:A8JNQ4	0.051	0.100	1.543E-4	796	0.066	0.144	A8JNQ4.pdb.gz	A8JNQ4_DROME RNA-binding Fox protein 1, isoform I OS=Drosophila melanogaster OX=7227 GN=Rbfox1 PE=4 SV=2
8	PDB:3lqvB	0.048	0.560	2.010E-4	115	0.012	0.183	3lqvB.pdb.gz	Branch Recognition by SF3b14
9	PDB:5vsuA	0.057	0.206	2.010E-4	387	0.025	0.114	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
10	AFDB:O60318	0.057	0.051	3.235E-4	1980	0.117	0.103	O60318.pdb.gz	GANP_HUMAN Germinal-center associated nuclear protein OS=Homo sapiens OX=9606 GN=MCM3AP PE=1 SV=2
11	PDB:1hl6A	0.043	0.555	3.634E-4	119	0.011	0.168	1hl6A.pdb.gz
12	PDB:6gd1A	0.043	0.367	4.428E-4	190	0.011	0.105	6gd1A.pdb.gz
13	AFDB:O43432	0.041	0.044	4.571E-4	1585	0.129	0.142	O43432.pdb.gz	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2
14	AFDB:H7C269	0.051	0.089	5.851E-4	906	0.082	0.157	H7C269.pdb.gz	H7C269_HUMAN Trinucleotide repeat containing adaptor 6A (Fragment) OS=Homo sapiens OX=9606 GN=TNRC6A PE=1 SV=1
15	PDB:5xjcw	0.044	0.732	6.572E-4	91	0.009	0.165	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
16	PDB:7d58O	0.057	0.137	8.412E-4	490	0.024	0.086	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
17	PDB:3pgwP	0.048	0.626	9.755E-4	113	0.010	0.150	3pgwP.pdb.gz
18	PDB:6ff7X	0.044	0.431	1.025E-3	171	0.009	0.094	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:7oqcF	0.048	0.270	1.188E-3	267	0.025	0.165	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
20	PDB:5gm6V	0.045	0.516	1.448E-3	128	0.011	0.148	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G8JLP4	0.0	1077	1577	0.292	0.322	G8JLP4_HUMAN Meiosis regulator and mRNA stability factor 1 OS=Homo sapiens OX=9606 GN=MARF1 PE=1 SV=1
2	Q8BJ34	0.0	3028	1730	0.858	0.864	MARF1_MOUSE Meiosis regulator and mRNA stability factor 1 OS=Mus musculus OX=10090 GN=Marf1 PE=1 SV=3
3	Q9Y4F3	0.0	3600	1742	1.000	1.000	MARF1_HUMAN Meiosis regulator and mRNA stability factor 1 OS=Homo sapiens OX=9606 GN=MARF1 PE=1 SV=6
4	Q7KWG9	4.29e-91	327	1305	0.113	0.151	Q7KWG9_DROME Meiosis regulator and mRNA stability factor 1, isoform D OS=Drosophila melanogaster OX=7227 GN=Marf1 PE=2 SV=1
5	Q9M1Q4	1.21e-10	68.9	673	0.024	0.061	Q9M1Q4_ARATH Endonuclease or glycosyl hydrolase OS=Arabidopsis thaliana OX=3702 GN=T17J13.160 PE=1 SV=1
6	Q9M1Q3	2.43e-10	65.9	279	0.026	0.161	Q9M1Q3_ARATH Endonuclease or glycosyl hydrolase OS=Arabidopsis thaliana OX=3702 GN=EDA32 PE=2 SV=1
7	F4K209	1.23e-07	59.3	995	0.026	0.045	F4K209_ARATH Endonuclease or glycosyl hydrolase with C2H2-type zinc finger domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=MAF19.19 PE=1 SV=1
8	Q6NQ97	3.51e-06	53.9	489	0.026	0.092	Q6NQ97_ARATH At2g15560 OS=Arabidopsis thaliana OX=3702 GN=At2g15560 PE=1 SV=1
9	Q9FIC2	2.43e-04	48.5	924	0.022	0.042	Q9FIC2_ARATH Emb
10	Q9FGG2	5.44e-04	47.4	841	0.020	0.042	Q9FGG2_ARATH Emb
11	Q9SJG8	0.15	39.3	843	0.014	0.028	AML2_ARATH Protein MEI2-like 2 OS=Arabidopsis thaliana OX=3702 GN=ML2 PE=2 SV=2
12	Q8MSI9	0.28	38.1	430	0.014	0.056	Q8MSI9_DROME GH11495p OS=Drosophila melanogaster OX=7227 GN=rump PE=2 SV=1
13	Q9VHC7	0.52	37.4	632	0.014	0.038	Q9VHC7_DROME FI21236p1 OS=Drosophila melanogaster OX=7227 GN=rump PE=1 SV=1
14	Q8VWF5	0.54	37.4	800	0.015	0.033	AML5_ARATH Protein MEI2-like 5 OS=Arabidopsis thaliana OX=3702 GN=ML5 PE=1 SV=1
15	P25555	0.82	36.6	427	0.014	0.059	GBP2_YEAST Serine/arginine (SR)-type shuttling mRNA binding protein GBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GBP2 PE=1 SV=1
16	Q8CHI8	1.0	37.0	3072	0.022	0.012	EP400_MOUSE E1A-binding protein p400 OS=Mus musculus OX=10090 GN=Ep400 PE=1 SV=3
17	O59670	1.1	34.3	115	0.011	0.165	SF3B6_SCHPO Splicing factor 3B subunit 6-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC29A3.07c PE=3 SV=2
18	Q9LZP4	1.1	35.4	200	0.011	0.100	Q9LZP4_ARATH AT3g62460/T12C14_160 OS=Arabidopsis thaliana OX=3702 GN=T12C14_160 PE=1 SV=1
19	Q6DBX4	1.3	36.2	860	0.015	0.031	GWL_DANRE Serine/threonine-protein kinase greatwall OS=Danio rerio OX=7955 GN=mastl PE=2 SV=1
20	Q9UT83	1.7	35.8	609	0.013	0.036	MUG28_SCHPO Meiotically up-regulated gene 28 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug28 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06289 FlbD	8.6e+02	11.0	Flagellar and Swarming motility proteins
2	PF19687 MARF1_LOTUS	5.2e-128	436.3	MARF1 LOTUS domain
3	PF11608 MARF1_RRM1	1.4e-19	81.4	MARF1, RNA recognition motif 1
4	PF01936 NYN	6.5e-16	70.6	NYN domain
5	PF12872 OST-HTH	9.5e-73	251.4	OST-HTH/LOTUS domain
6	PF00076 RRM_1	0.0007	30.7	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379654

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000255759	0.779	LisH domain-containing protein FOPNL
2	9606.ENSP00000300006	0.776	Uncharacterized protein C16orf45
3	9606.ENSP00000476046	0.747	mRNA-decapping enzyme 1A
4	9606.ENSP00000351811	0.729	Enhancer of mRNA-decapping protein 4
5	9606.ENSP00000287706	0.705	Protein N-terminal asparagine amidohydrolase
6	9606.ENSP00000198767	0.682	RNA polymerase I-specific transcription initiation factor RRN3
7	9606.ENSP00000379643	0.681	Nuclear distribution protein nudE homolog 1
8	9606.ENSP00000379669	0.653	Mpv17-like protein
9	9606.ENSP00000340474	0.630	Exonuclease mut-7 homolog
10	9606.ENSP00000406052	0.607	Tudor domain-containing protein 5
11	9606.ENSP00000429615	0.606	3'-5' exoribonuclease 1
12	9606.ENSP00000382274	0.603	Nodal modulator 3
13	9606.ENSP00000379691	0.601	Pyridoxal-dependent decarboxylase domain-containing protein 1
14	9606.ENSP00000320503	0.566	Enhancer of mRNA-decapping protein 3
15	9606.ENSP00000262384	0.563	NEDD4-binding protein 1
16	9606.ENSP00000251343	0.562	Protein KHNYN
17	9606.ENSP00000400513	0.549	FAST kinase domain-containing protein 1, mitochondrial
18	9606.ENSP00000373715	0.533	m7GpppN-mRNA hydrolase
19	9606.ENSP00000205557	0.525	Multidrug resistance-associated protein 6
20	9606.ENSP00000370908	0.518	Protein LOC101930008

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.864	organic cyclic compound binding
GO:1901363	0.858	heterocyclic compound binding
GO:0003676	0.852	nucleic acid binding
GO:0003723	0.829	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050789	0.985	regulation of biological process
GO:0071704	0.978	organic substance metabolic process
GO:0044237	0.977	cellular metabolic process
GO:0071840	0.973	cellular component organization or biogenesis
GO:0044238	0.973	primary metabolic process
GO:0006807	0.964	nitrogen compound metabolic process
GO:0032501	0.955	multicellular organismal process
GO:0043170	0.955	macromolecule metabolic process
GO:0034641	0.949	cellular nitrogen compound metabolic process
GO:1901360	0.948	organic cyclic compound metabolic process
GO:0046483	0.948	heterocycle metabolic process
GO:0006725	0.948	cellular aromatic compound metabolic process
GO:0060255	0.946	regulation of macromolecule metabolic process
GO:0016043	0.943	cellular component organization
GO:0090304	0.938	nucleic acid metabolic process
GO:0010468	0.929	regulation of gene expression
GO:0044260	0.923	cellular macromolecule metabolic process
GO:0019953	0.922	sexual reproduction
GO:0032502	0.919	developmental process
GO:0032504	0.907	multicellular organism reproduction
GO:0007049	0.902	cell cycle
GO:0048609	0.895	multicellular organismal reproductive process
GO:0007276	0.894	gamete generation
GO:0048856	0.887	anatomical structure development
GO:0050896	0.868	response to stimulus
GO:0022412	0.812	cellular process involved in reproduction in multicellular organism
GO:0006950	0.732	response to stress
GO:0006996	0.725	organelle organization
GO:0050794	0.631	regulation of cellular process
GO:0022402	0.504	cell cycle process
GO:0051716	0.471	cellular response to stimulus
GO:0048869	0.421	cellular developmental process
GO:0030154	0.414	cell differentiation
GO:0033554	0.405	cellular response to stress
GO:0007292	0.392	female gamete generation
GO:0006974	0.370	cellular response to DNA damage stimulus
GO:0048519	0.335	negative regulation of biological process
GO:0006259	0.318	DNA metabolic process
GO:0048477	0.317	oogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005794	0.997	Golgi apparatus
GO:0043232	0.908	intracellular non-membrane-bounded organelle
GO:0005634	0.890	nucleus
GO:0070013	0.835	intracellular organelle lumen
GO:0031981	0.778	nuclear lumen
GO:0005654	0.765	nucleoplasm
GO:0005829	0.687	cytosol
GO:0042579	0.599	microbody
GO:0005777	0.574	peroxisome
GO:0035770	0.397	ribonucleoprotein granule
GO:0036464	0.385	cytoplasmic ribonucleoprotein granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]