StarFunc result for job id Q9Y4F4

User Input

>input (1720 residues)
MAAAPSALLLLPPFPVLSTYRLQSRSRPSAPETDDSRVGGIMRGEKNYYFRGAAGDHGSC
PTTTSPLASALLMPSEAVSSSWSESGGGLSGGDEEDTRLLQLLRTARDPSEAFQALQAAL
PRRGGRLGFPRRKEALYRALGRVLVEGGSDEKRLCLQLLSDVLRGQGEAGQLEEAFSLAL
LPQLVVSLREENPALRKDALQILHICLKRSPGEVLRTLIQQGLESTDARLRASTALLLPI
LLTTEDLLLGLDLTEVIISLARKLGDQETEEESETAFSALQQIGERLGQDRFQSYISRLP
SALRRHYNRRLESQFGSQVPYYLELEASGFPEDPLPCAVTLSNSNLKFGIIPQELHSRLL
DQEDYKNRTQAVEELKQVLGKFNPSSTPHSSLVGFISLLYNLLDDSNFKVVHGTLEVLHL
LVIRLGEQVQQFLGPVIAASVKVLADNKLVIKQEYMKIFLKLMKEVGPQQVLCLLLEHLK
HKHSRVREEVVNICICSLLTYPSEDFDLPKLSFDLAPALVDSKRRVRQAALEAFAVLASS
MGSGKTSILFKAVDTVELQDNGDGVMNAVQARLARKTLPRLTEQGFVEYAVLMPSSAGGR
SNHLAHGADTDWLLAGNRTQSAHCHCGDHVRDSMHIYGSYSPTICTRRVLSAGKGKNKLP
WENEQPGIMGENQTSTSKDIEQFSTYDFIPSAKLKLSQGMPVNDDLCFSRKRVSRNLFQN
SRDFNPDCLPLCAAGTTGTHQTNLSGKCAQLGFSQICGKTGSVGSDLQFLGTTSSHQEKV
YASLNFGSKTQQTFGSQTECTSSNGQNPSPGAYILPSYPVSSPRTSPKHTSPLIISPKKS
QDNSVNFSNSWPLKSFEGLSKPSPQKKLVSQKSSDPTGRNHGENSQEKPPVQLTPALVRS
PSSRRGLNGTKPVPPIPRGISLLPDKADLSTVGHKKKEPDDIWKCEKDSLPIDLSELNFK
DKDLDQEEMHSSLRSLRNSAAKKRAKLSGSTSDLESPDSAMKLDLTMDSPSLSSSPNINS
YSESGVYSQESLTSSLSTTPQGKRIMSDIFPTFGSKPCPTRLSSAKKKISHIAEQSPSAG
SSSNPQQISSFDFTTTKALSEDSVVVVGKGVFGSLSSAPATCSQSVISSVENGDTFSIKQ
SIEPPSGIYGRSVQQNISSYLDVENEKDAKVSISKSTYNKMRQKRKEEKELFHNKDCEKK
EKNSWERMRHTGTEKMASESETPTGAISQYKERMPSVTHSPEIMDLSELRPFSKPEIALT
EALRLLADEDWEKKIEGLNFIRCLAAFHSEILNTKLHETNFAVVQEVKNLRSGVSRAAVV
CLSDLFTYLKKSMDQELDTTVKVLLHKAGESNTFIREDVDKALRAMVNNVTPARAVVSLI
NGGQRYYGRKMLFFMMCHPNFEKMLEKYVPSKDLPYIKDSVRNLQQKGLGEIPLDTPSAK
GRRSHTGSVGNTRSSSVSRDAFNSAERAVTEVREVTRKSVPRNSLESAEYLKLITGLLNA
KDFRDRINGIKQLLSDTENNQDLVVGNIVKIFDAFKSRLHDSNSKVNLVALETMHKMIPL
LRDHLSPIINMLIPAIVDNNLNSKNPGIYAAATNVVQALSQHVDNYLLLQPFCTKAQFLN
GKAKQDMTEKLADIVTELYQRKPHATEQKVLVVLWHLLGNMTNSGSLPGAGGNIRTATAK
LSKALFAQMGQNLLNQAASQPPHIKKSLEELLDMTILNEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6A070	0.398	0.387	0.000	1776	0.863	0.836	Q6A070.pdb.gz	TGRM1_MOUSE TOG array regulator of axonemal microtubules protein 1 OS=Mus musculus OX=10090 GN=Togaram1 PE=1 SV=3
2	AFDB:Q9Y4F4	1.000	1.000	0.000	1720	1.000	1.000	Q9Y4F4.pdb.gz	TGRM1_HUMAN TOG array regulator of axonemal microtubules protein 1 OS=Homo sapiens OX=9606 GN=TOGARAM1 PE=1 SV=4
3	PDB:4jlqA	0.098	0.179	9.152E-7	840	0.046	0.094	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
4	PDB:1b3uA	0.103	0.267	1.062E-6	588	0.047	0.138	1b3uA.pdb.gz
5	PDB:7rroH7	0.084	0.199	1.595E-5	580	0.049	0.147	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
6	PDB:6ahd1	0.086	0.126	1.718E-5	1048	0.048	0.079	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
7	PDB:5tbkA	0.091	0.300	2.584E-5	417	0.033	0.137	5tbkA.pdb.gz
8	PDB:3w3uA	0.103	0.164	2.783E-5	1030	0.039	0.065	3w3uA.pdb.gz
9	PDB:7cunG	0.102	0.178	2.998E-5	895	0.042	0.082	7cunG.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
10	AFDB:C9JFV4	0.087	0.118	4.262E-5	1180	0.110	0.160	C9JFV4.pdb.gz	C9JFV4_HUMAN Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2
11	PDB:4tnmA	0.087	0.281	5.041E-5	407	0.034	0.145	4tnmA.pdb.gz
12	PDB:1wa5B	0.085	0.246	5.231E-5	466	0.033	0.120	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
13	PDB:3tpoA	0.086	0.264	5.635E-5	438	0.033	0.128	3tpoA.pdb.gz
14	AFDB:Q9DBD5	0.095	0.122	8.313E-5	1123	0.105	0.160	Q9DBD5.pdb.gz	PELP1_MOUSE Proline-, glutamic acid- and leucine-rich protein 1 OS=Mus musculus OX=10090 GN=Pelp1 PE=1 SV=2
15	AFDB:Q6PR54	0.081	0.062	1.621E-4	2419	0.111	0.079	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
16	AFDB:Q5UIP0	0.095	0.071	1.952E-4	2472	0.104	0.072	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
17	AFDB:Q21227	0.090	0.121	4.256E-4	1188	0.097	0.140	Q21227.pdb.gz	APR1_CAEEL Adenomatous polyposis coli protein-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=apr-1 PE=1 SV=2
18	AFDB:Q9VAS9	0.076	0.060	4.256E-4	2417	0.107	0.076	Q9VAS9.pdb.gz	Q9VAS9_DROME APC-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Apc PE=3 SV=1
19	AFDB:O95996	0.078	0.062	6.403E-4	2303	0.111	0.083	O95996.pdb.gz	APCL_HUMAN Adenomatous polyposis coli protein 2 OS=Homo sapiens OX=9606 GN=APC2 PE=1 SV=1
20	AFDB:Q9P2D8	0.072	0.052	1.249E-3	2635	0.142	0.093	Q9P2D8.pdb.gz	UNC79_HUMAN Protein unc-79 homolog OS=Homo sapiens OX=9606 GN=UNC79 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6A070	0.0	2972	1776	0.866	0.839	TGRM1_MOUSE TOG array regulator of axonemal microtubules protein 1 OS=Mus musculus OX=10090 GN=Togaram1 PE=1 SV=3
2	Q9Y4F4	0.0	3541	1720	1.000	1.000	TGRM1_HUMAN TOG array regulator of axonemal microtubules protein 1 OS=Homo sapiens OX=9606 GN=TOGARAM1 PE=1 SV=4
3	Q17423	5.45e-37	155	1282	0.085	0.114	CREC_CAEEL Crescerin-like protein che-12 OS=Caenorhabditis elegans OX=6239 GN=che-12 PE=1 SV=3
4	A0A0G2JUI5	6.57e-09	63.5	1539	0.034	0.038	A0A0G2JUI5_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=2
5	A0A8I6AEZ5	6.87e-09	63.5	1555	0.034	0.038	A0A8I6AEZ5_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=1
6	F1LNQ9	6.97e-09	63.5	1539	0.034	0.038	F1LNQ9_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=4
7	Q7Z460	7.09e-09	63.5	1538	0.034	0.038	CLAP1_HUMAN CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1 PE=1 SV=1
8	E7ERI8	7.56e-09	63.5	1513	0.032	0.036	E7ERI8_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=1
9	F1LNR0	7.57e-09	63.5	1529	0.034	0.039	F1LNR0_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=4
10	E7EW49	7.88e-09	63.5	1514	0.032	0.036	E7EW49_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=1
11	Q8RWY6	1.08e-08	62.8	1439	0.030	0.035	CLASP_ARATH CLIP-associated protein OS=Arabidopsis thaliana OX=3702 GN=CLASP PE=1 SV=1
12	A0A8I5ZL32	1.10e-08	62.8	1495	0.034	0.039	A0A8I5ZL32_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=1
13	A0A0G2JTD7	1.22e-08	62.8	1420	0.034	0.042	A0A0G2JTD7_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=2
14	A0A1B0GWM1	1.27e-08	62.8	1478	0.034	0.040	A0A1B0GWM1_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=2
15	F1LNR1	1.31e-08	62.8	1470	0.034	0.040	F1LNR1_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=4
16	Q80TV8	1.37e-08	62.8	1535	0.028	0.031	CLAP1_MOUSE CLIP-associating protein 1 OS=Mus musculus OX=10090 GN=Clasp1 PE=1 SV=2
17	Q9NBD7	1.12e-05	53.1	1491	0.026	0.030	CLASP_DROME CLIP-associating protein OS=Drosophila melanogaster OX=7227 GN=chb PE=1 SV=1
18	Q09543	0.44	37.7	590	0.028	0.083	2AAA_CAEEL Probable serine/threonine-protein phosphatase PP2A regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=paa-1 PE=1 SV=2
19	Q9P371	0.63	37.0	435	0.028	0.113	SST2_SCHPO AMSH-like protease sst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sst2 PE=1 SV=1
20	P46675	1.3	36.2	888	0.026	0.051	STU2_YEAST Protein STU2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STU2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16600 Caskin1-CID	3.2e+02	13.1	Caskin1 CASK-interaction domain
2	PF12348 CLASP_N	0.0057	27.8	CLASP N terminal
3	PF12717 Cnd1	1.3e+02	14.1	non-SMC mitotic condensation complex subunit 1
4	PF04118 Dopey_N	6.5	17.4	Dopey, N-terminal
5	PF04286 DUF445	1.4e+02	13.7	Protein of unknown function (DUF445)
6	PF02985 HEAT	1.3e+02	14.2	HEAT repeat
7	PF13646 HEAT_2	0.02	26.6	HEAT repeats
8	PF13513 HEAT_EZ	3.1e+02	13.4	HEAT-like repeat
9	PF14500 MMS19_N	3.9	18.5	Dos2-interacting transcription regulator of RNA-Pol-II
10	PF15048 OSTbeta	6.5e+02	11.8	Organic solute transporter subunit beta protein
11	PF10274 ParcG	4.2	19.0	Parkin co-regulated protein
12	PF10363 RTP1_C1	9.5e+02	11.4	Required for nuclear transport of RNA pol II C-terminus 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355045

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379434	0.768	Kelch-like protein 28
2	9606.ENSP00000381857	0.705	Maestro heat like repeat family member 6
3	9606.ENSP00000261556	0.681	Transmembrane protein 260
4	9606.ENSP00000327468	0.676	Kelch domain-containing protein 8B
5	9606.ENSP00000385957	0.648	Kelch repeat and BTB domain containing 12
6	9606.ENSP00000350378	0.636	Golgin subfamily A member 7
7	9606.ENSP00000297001	0.632	Spermatogenesis-associated protein 48
8	9606.ENSP00000391788	0.622	Interactor of HORMAD1 protein 1
9	9606.ENSP00000369349	0.610	Keratin, type II cuticular Hb1
10	9606.ENSP00000432768	0.607	Cytoskeleton-associated protein 5
11	9606.ENSP00000454945	0.600	Transmembrane protein 204
12	9606.ENSP00000356071	0.590	Protein SERAC1
13	9606.ENSP00000348010	0.588	Pre-mRNA-processing factor 39
14	9606.ENSP00000330289	0.574	Trafficking protein particle complex subunit 6B
15	9606.ENSP00000410811	0.570	Fidgetin-like protein 1
16	9606.ENSP00000386499	0.557	Proline-rich protein 35
17	9606.ENSP00000473941	0.549	Protein HEATR9
18	9606.ENSP00000259708	0.545	Kinesin light chain 4
19	9606.ENSP00000484804	0.541	LisH domain-containing protein ARMC9
20	9606.ENSP00000244496	0.537	Ribosomal RNA processing protein 36 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0071840	0.980	cellular component organization or biogenesis
GO:0006996	0.956	organelle organization
GO:0022607	0.946	cellular component assembly
GO:0044782	0.836	cilium organization
GO:0065007	0.804	biological regulation
GO:0030031	0.783	cell projection assembly
GO:0070925	0.745	organelle assembly
GO:0050789	0.676	regulation of biological process
GO:0120031	0.644	plasma membrane bounded cell projection assembly
GO:0050794	0.614	regulation of cellular process
GO:0060271	0.406	cilium assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005929	1.000	cilium
GO:0005856	1.000	cytoskeleton
GO:0005737	0.976	cytoplasm
GO:0015630	0.834	microtubule cytoskeleton
GO:0043231	0.811	intracellular membrane-bounded organelle
GO:0099512	0.713	supramolecular fiber
GO:0099513	0.626	polymeric cytoskeletal fiber
GO:0005815	0.584	microtubule organizing center
GO:0036064	0.543	ciliary basal body
GO:0099568	0.528	cytoplasmic region
GO:0005874	0.486	microtubule
GO:0005829	0.471	cytosol
GO:0032838	0.435	plasma membrane bounded cell projection cytoplasm
GO:0005930	0.427	axoneme
GO:0005634	0.337	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]