StarFunc result for job id Q9Y4F5

User Input

>input (1589 residues)
MSATSWFLVSSSGARHRLPRELIFVGREECELMLQSRSVDKQHAVINYDQDRDEHWVKDL
GSLNGTFVNDMRIPDQKYVTLKLNDVIRFGYDSNMYVLERVQHRVPEEALKHEKYTSQLQ
VSVKGLAPKRSEALPEHTPYCEASNPRPEKGDRRPGTEAASYRTPLYGQPSWWGEDDGST
LPDAQRQGEPYPERPKGPVQQDGELHGFRAPAEPQGCSFRREPSYFEIPTKETPQPSQPP
EVPAHEMPTKDAEAGGGGAAPVVQSHASFTIEFDDCSPGKMKIKDHITKFSLRQRRPPGK
EATPGEMVSAETKVADWLVQNDPSLLHRVGPGDDRHSTKSDLPVHTRTLKGHKHEDGTQS
DSEDPLAKAASAAGVPLEASGEQVRLQRQIKRDPQELLHNQQAFVIEFFDEDTPRKKRSQ
SFTHSPSGDPKADKRRGPTPADRDRPSVPAPVQAGGRSSGPQRAGSLKREKTEERLGSPS
PASRTPARPFGSVGRRSRLAQDFMAQCLRESSPAARPSPEKVPPVLPAPLTPHGTSPVGP
PTPPPAPTDPQLTKARKQEEDDSLSDAGTYTIETEAQDTEVEEARKMIDQVFGVLESPEL
SRASSATFRPVIRGDRDESDDGGVAQRMALLQEFASRPLGAAPQAEHQGLPVPGSPGGQK
WVSRWASLADSYSDPGLTEDGLGRRGGEPEGSLPVRMRRRLPQLPSERADSPAGPESSRR
SGPGPPELDSEQPSRLFGQEELDPDSLSDASGSDGGRGPEPGVEPQDSRRRSPQEGPTWS
RGRRSPRAPGEPTPASFFIGDQNGDAVLSRKPLAAPGDGEGLGQTAQPSPPARDGVYVSA
NGRMVIQLRPGRSPEPDGPAPAFLRQESFTKEPASGPPAPGKPPHISSHPLLQDLAATRA
ARMDFHSQDTHLILKETETALAALEARLLSNSVDAECEGGSTPRPPEDALSGDSDVDTAS
TVSLRSGKSGPSPTTPQPLRAQKEMSPSPPAAQDPGGTALVSAREQSSERQHHPLGPTDM
GRGEPVRRSAIRRGHRPRGSLDWPSEERGPVLAHLPSSDVMASNHETPEATGAGRLGSRR
KPAAPPPSPAAREEQSRSSASSQKGPQALTRSNSLSTPRPTRASRLRRARLGDASDTEAA
DGERGSLGNPEPVGRPAAEQAKKLSRLDILAMPRKRAGSFTGTSDPEAAPARTSFSGRSV
ELCCASRKPTMAEARAVSRKAANTATTTGPRQPFSRARSGSARYTSNTRRRQQGSDYTST
SEEEYGSRHGSPKHTRSHTSTATQTPRAGSSSRARSRAPGPRDTDDDEEEPDPYGFIVQT
AEIAEIARLSQTLVKDVAILAQEIHDVAGDGDTLGSSEPAHSASLSNMPSTPASTISARE
ELVQRIPEASLNFQKVPPGSLNSRDFDQNMNDSCEDALANKTRPRNREEVIFDNLMLNPV
SQLSQAIRENTEHLAEKMKILFQNTGRAWEDLEARINAENEVPILKTSNKEISSILKELR
RVQKQLEVINAIVDPSGSLDLLTGNRSLASSAQPGLGKGRVAAQSPPSPASAEALLPALP
LRNFPQRASCGPPSLPDPTFLPDAERFLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y4F5	0.999	0.999	0.000	1589	1.000	1.000	Q9Y4F5.pdb.gz	C170B_HUMAN Centrosomal protein of 170 kDa protein B OS=Homo sapiens OX=9606 GN=CEP170B PE=1 SV=4
2	AFDB:Q6A065	0.108	0.108	2.094E-62	1588	0.349	0.349	Q6A065.pdb.gz	CE170_MOUSE Centrosomal protein of 170 kDa OS=Mus musculus OX=10090 GN=Cep170 PE=1 SV=2
3	AFDB:Q5SW79	0.100	0.100	1.479E-60	1584	0.349	0.350	Q5SW79.pdb.gz	CE170_HUMAN Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1
4	AFDB:B7SY83	0.071	0.076	3.859E-11	1477	0.138	0.148	B7SY83.pdb.gz	PS1_ARATH FHA domain-containing protein PS1 OS=Arabidopsis thaliana OX=3702 GN=PS1 PE=2 SV=1
5	PDB:7dvqX	0.060	0.555	1.487E-9	156	0.022	0.224	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
6	AFDB:Q95RC8	0.062	0.075	5.818E-9	1280	0.116	0.144	Q95RC8.pdb.gz	Q95RC8_DROME LD44171p OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
7	AFDB:O96685	0.061	0.075	2.225E-8	1261	0.104	0.132	O96685.pdb.gz	O96685_DROME Mutator 2 OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
8	AFDB:E2QD98	0.040	0.030	7.144E-8	2020	0.132	0.104	E2QD98.pdb.gz	E2QD98_DROME Stardust, isoform G OS=Drosophila melanogaster OX=7227 GN=sdt PE=1 SV=1
9	PDB:2ff4A	0.057	0.233	1.881E-7	379	0.017	0.071	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
10	AFDB:Q14676	0.070	0.055	3.450E-7	2089	0.166	0.126	Q14676.pdb.gz	MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3
11	PDB:5gm6U	0.061	0.506	3.574E-7	176	0.021	0.188	5gm6U.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
12	PDB:5z56X	0.061	0.525	3.788E-7	159	0.017	0.170	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
13	AFDB:Q5PSV9	0.061	0.057	5.501E-7	1707	0.167	0.155	Q5PSV9.pdb.gz	MDC1_MOUSE Mediator of DNA damage checkpoint protein 1 OS=Mus musculus OX=10090 GN=Mdc1 PE=1 SV=1
14	PDB:7wrgA	0.057	0.107	8.104E-5	812	0.011	0.022	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
15	PDB:6l9wD	0.051	0.490	1.632E-4	142	0.010	0.113	6l9wD.pdb.gz
16	PDB:7wrgB	0.057	0.112	1.730E-4	783	0.013	0.026	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
17	AFDB:Q8N3D4	0.041	0.043	2.369E-4	1523	0.153	0.160	Q8N3D4.pdb.gz	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2
18	PDB:2fe0A	0.024	0.189	7.898E-2	131	0.006	0.076	2fe0A.pdb.gz
19	PDB:7vvuV	0.027	0.279	1.686E-1	113	0.011	0.159	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
20	PDB:5ejgC	0.047	0.254	1.894E-1	218	0.007	0.050	5ejgC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y4F5	0.0	3186	1589	1.000	1.000	C170B_HUMAN Centrosomal protein of 170 kDa protein B OS=Homo sapiens OX=9606 GN=CEP170B PE=1 SV=4
2	H0Y2V6	7.41e-153	509	1558	0.325	0.332	H0Y2V6_HUMAN Centrosomal protein 170 (Fragment) OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1
3	Q6A065	1.96e-104	370	1588	0.130	0.130	CE170_MOUSE Centrosomal protein of 170 kDa OS=Mus musculus OX=10090 GN=Cep170 PE=1 SV=2
4	Q5SW79	1.44e-100	358	1584	0.124	0.124	CE170_HUMAN Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1
5	E7EMW0	1.29e-39	152	320	0.061	0.303	E7EMW0_HUMAN Centrosomal protein 170 OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1
6	Q96L14	4.64e-38	147	293	0.058	0.314	C170L_HUMAN Cep170-like protein OS=Homo sapiens OX=9606 GN=CEP170P1 PE=5 SV=2
7	E7EWM2	2.25e-37	145	293	0.057	0.311	E7EWM2_HUMAN Centrosomal protein 170 OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1
8	H0Y4T4	1.31e-23	104	263	0.044	0.266	H0Y4T4_HUMAN Centrosomal protein 170 (Fragment) OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1
9	E5RG47	8.34e-22	96.3	175	0.042	0.383	E5RG47_HUMAN Centrosomal protein 170 (Fragment) OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1
10	B1AK66	1.33e-08	61.2	396	0.021	0.086	B1AK66_HUMAN Smad nuclear interacting protein 1 OS=Homo sapiens OX=9606 GN=SNIP1 PE=2 SV=1
11	Q8TAD8	1.33e-08	61.2	396	0.021	0.086	SNIP1_HUMAN Smad nuclear-interacting protein 1 OS=Homo sapiens OX=9606 GN=SNIP1 PE=1 SV=1
12	Q8BIZ6	1.64e-08	60.8	383	0.021	0.089	SNIP1_MOUSE Smad nuclear-interacting protein 1 OS=Mus musculus OX=10090 GN=Snip1 PE=1 SV=1
13	Q4V8W8	1.58e-07	57.8	374	0.021	0.088	Q4V8W8_DANRE Smad nuclear-interacting protein OS=Danio rerio OX=7955 GN=snip1 PE=1 SV=1
14	E9Q585	2.16e-07	58.2	715	0.020	0.043	E9Q585_MOUSE Solute carrier family 4 (anion exchanger), member 1, adaptor protein OS=Mus musculus OX=10090 GN=Slc4a1ap PE=1 SV=1
15	E9PX68	2.32e-07	58.2	744	0.020	0.042	E9PX68_MOUSE Solute carrier family 4 (anion exchanger), member 1, adaptor protein OS=Mus musculus OX=10090 GN=Slc4a1ap PE=1 SV=1
16	E9Q1Q0	2.85e-07	57.4	534	0.020	0.058	E9Q1Q0_MOUSE Solute carrier family 4 (anion exchanger), member 1, adaptor protein OS=Mus musculus OX=10090 GN=Slc4a1ap PE=1 SV=1
17	Q6GQW1	3.01e-07	57.4	537	0.018	0.054	Q6GQW1_MOUSE Slc4a1ap protein (Fragment) OS=Mus musculus OX=10090 GN=Slc4a1ap PE=2 SV=1
18	Q3UUI2	3.51e-07	57.4	536	0.020	0.058	Q3UUI2_MOUSE FHA domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Slc4a1ap PE=2 SV=1
19	A0A087X0M4	7.49e-07	56.6	742	0.016	0.035	A0A087X0M4_HUMAN Solute carrier family 4 member 1 adaptor protein OS=Homo sapiens OX=9606 GN=SLC4A1AP PE=1 SV=1
20	Q9BWU0	7.52e-07	56.6	796	0.016	0.031	NADAP_HUMAN Kanadaptin OS=Homo sapiens OX=9606 GN=SLC4A1AP PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15308 CEP170_C	0	1055.3	CEP170 C-terminus
2	PF00498 FHA	1.6e-13	62.1	FHA domain
3	PF08429 PLU-1	2.7e+02	12.1	PLU-1-like protein
4	PF16697 Yop-YscD_cpl	1.9e-05	36.2	Inner membrane component of T3SS, cytoplasmic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003807043.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008949915.1	0.701	Ankyrin repeat domain 28
2	9597.XP_008975563.1	0.695	Microtubule associated tumor suppressor 1
3	9597.XP_008976918.1	0.685	Ankyrin repeat domain 52
4	9597.XP_008961621.1	0.647	Serine/threonine-protein phosphatase 6 regulatory subunit 2 isoform X1
5	9597.XP_003808484.1	0.537	Deoxynucleotidyltransferase terminal interacting protein 2
6	9597.XP_008955332.1	0.519	Ninein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.972	regulation of cellular process
GO:0048518	0.733	positive regulation of biological process
GO:0023051	0.679	regulation of signaling
GO:0048583	0.643	regulation of response to stimulus
GO:0071840	0.364	cellular component organization or biogenesis
GO:0050896	0.348	response to stimulus
GO:0010646	0.345	regulation of cell communication
GO:0019222	0.343	regulation of metabolic process
GO:0016043	0.328	cellular component organization
GO:0008152	0.327	metabolic process
GO:0048522	0.317	positive regulation of cellular process
GO:0060255	0.302	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0005829	0.999	cytosol
GO:0005815	0.986	microtubule organizing center
GO:0043227	0.981	membrane-bounded organelle
GO:0043231	0.951	intracellular membrane-bounded organelle
GO:0016020	0.936	membrane
GO:0005634	0.803	nucleus
GO:0071944	0.744	cell periphery
GO:0005886	0.670	plasma membrane
GO:0070013	0.539	intracellular organelle lumen
GO:0031981	0.533	nuclear lumen
GO:0005654	0.478	nucleoplasm
GO:0005814	0.340	centriole

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]