StarFunc result for job id Q9Y4F9

User Input

>input (1068 residues)
MLVGSQSFSPGGPNGIIRSQSFAGFSGLQERRSRCNSFIENSSALKKPQAKLKKMHNLGH
KNNNPPKEPQPKRVEEVYRALKNGLDEYLEVHQTELDKLTAQLKDMKRNSRLGVLYDLDK
QIKTIERYMRRLEFHISKVDELYEAYCIQRRLQDGASKMKQAFATSPASKAARESLTEIN
RSFKEYTENMCTIEVELENLLGEFSIKMKGLAGFARLCPGDQYEIFMKYGRQRWKLKGKI
EVNGKQSWDGEETVFLPLIVGFISIKVTELKGLATHILVGSVTCETKELFAARPQVVAVD
INDLGTIKLNLEITWYPFDVEDMTASSGAGNKAAALQRRMSMYSQGTPETPTFKDHSFFR
WLHPSPDKPRRLSVLSALQDTFFAKLHRSRSFSDLPSLRPSPKAVLELYSNLPDDIFENG
KAAEEKMPLSLSFSDLPNGDCALTSHSTGSPSNSTNPEITITPAEFNLSSLASQNEGMDD
TSSASSRNSLGEGQEPKSHLKEEDPEEPRKPASAPSEACRRQSSGAGAEHLFLENDVAEA
LLQESEEASELKPVELDTSEGNITKQLVKRLTSAEVPMATDRLLSEGSVGGESEGCRSFL
DGSLEDAFNGLLLALEPHKEQYKEFQDLNQEVMNLDDILKCKPAVSRSRSSSLSLTVESA
LESFDFLNTSDFDEEEDGDEVCNVGGGADSVFSDTETEKHSYRSVHPEARGHLSEALTED
TGVGTSVAGSPLPLTTGNESLDITIVRHLQYCTQLVQQIVFSSKTPFVARSLLEKLSRQI
QVMEKLAAVSDENIGNISSVVEAIPEFHKKLSLLSFWTKCCSPVGVYHSPADRVMKQLEA
SFARTVNKEYPGLADPVFRTLVSQILDRAEPLLSSSLSSEVVTVFQYYSYFTSHGVSDLE
SYLSQLARQVSMVQTLQSLRDEKLLQTMSDLAPSNLLAQQEVLRTLALLLTREDNEVSEA
VTLYLAAASKNQHFREKALLYYCEALTKTNLQLQKAACLALKILEATESIKMLVTLCQSD
TEEIRNVASETLLSLGEDGRLAYEQLDKFPRDCVKVGGRHGTEVATAF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A9ZLX4	0.543	0.541	0.000	1072	0.737	0.734	A9ZLX4.pdb.gz	RIPR2_COTJA Rho family-interacting cell polarization regulator 2 OS=Coturnix japonica OX=93934 GN=RIPOR2 PE=1 SV=1
2	AFDB:Q9Y4F9	1.000	1.000	0.000	1068	1.000	1.000	Q9Y4F9.pdb.gz	RIPR2_HUMAN Rho family-interacting cell polarization regulator 2 OS=Homo sapiens OX=9606 GN=RIPOR2 PE=1 SV=4
3	AFDB:Q1LU99	0.308	0.304	1.436E-77	1083	0.547	0.539	Q1LU99.pdb.gz	RIPR2_DANRE Rho family-interacting cell polarization regulator 2 OS=Danio rerio OX=7955 GN=ripor2 PE=2 SV=1
4	AFDB:Q96MK2	0.313	0.351	2.829E-57	946	0.337	0.381	Q96MK2.pdb.gz	RIPR3_HUMAN RIPOR family member 3 OS=Homo sapiens OX=9606 GN=RIPOR3 PE=1 SV=4
5	AFDB:Q6ZS17	0.321	0.284	3.087E-57	1223	0.369	0.322	Q6ZS17.pdb.gz	RIPR1_HUMAN Rho family-interacting cell polarization regulator 1 OS=Homo sapiens OX=9606 GN=RIPOR1 PE=1 SV=1
6	AFDB:Q68FE6	0.312	0.276	1.093E-56	1223	0.381	0.333	Q68FE6.pdb.gz	RIPR1_MOUSE Rho family-interacting cell polarization regulator 1 OS=Mus musculus OX=10090 GN=Ripor1 PE=1 SV=2
7	AFDB:B0G181	0.101	0.107	1.917E-6	968	0.103	0.114	B0G181.pdb.gz	B0G181_DICDI Dilute domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0291396 PE=4 SV=1
8	AFDB:M9PDD2	0.092	0.144	2.124E-4	655	0.067	0.110	M9PDD2.pdb.gz	M9PDD2_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=anon-WO0118547.182 PE=3 SV=1
9	AFDB:Q9C6S1	0.072	0.064	4.457E-4	1230	0.124	0.107	Q9C6S1.pdb.gz	FH14_ARATH Formin-like protein 14 OS=Arabidopsis thaliana OX=3702 GN=FH14 PE=3 SV=3
10	AFDB:Q8R361	0.101	0.158	6.598E-4	645	0.068	0.113	Q8R361.pdb.gz	RFIP5_MOUSE Rab11 family-interacting protein 5 OS=Mus musculus OX=10090 GN=Rab11fip5 PE=1 SV=2
11	PDB:5a50A	0.091	0.458	3.371E-3	165	0.022	0.145	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
12	PDB:1cjyA	0.091	0.147	4.192E-3	633	0.015	0.025	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
13	PDB:4rj9A	0.095	0.504	8.795E-3	161	0.020	0.130	4rj9A.pdb.gz
14	PDB:5a52A	0.093	0.531	1.142E-2	154	0.017	0.117	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
15	PDB:5iz5A	0.089	0.123	2.981E-2	757	0.010	0.015	5iz5A.pdb.gz
16	PDB:5izrC	0.085	0.132	4.044E-2	659	0.012	0.020	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
17	PDB:5iz5B	0.091	0.127	4.815E-2	746	0.013	0.019	5iz5B.pdb.gz
18	PDB:6jxrm	0.053	0.172	6.254E-2	248	0.019	0.081	6jxrm.pdb.gz
19	PDB:3nsjA	0.084	0.158	7.128E-2	530	0.017	0.034	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
20	PDB:5ixcA	0.087	0.132	7.128E-2	684	0.012	0.019	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A9ZLX4	0.0	1581	1072	0.742	0.739	RIPR2_COTJA Rho family-interacting cell polarization regulator 2 OS=Coturnix japonica OX=93934 GN=RIPOR2 PE=1 SV=1
2	Q1LU99	0.0	1062	1083	0.548	0.540	RIPR2_DANRE Rho family-interacting cell polarization regulator 2 OS=Danio rerio OX=7955 GN=ripor2 PE=2 SV=1
3	Q7TP54	0.0	1566	1310	0.795	0.648	RIPR2_RAT Rho family-interacting cell polarization regulator 2 OS=Rattus norvegicus OX=10116 GN=Ripor2 PE=1 SV=1
4	Q80U16	0.0	1779	1078	0.875	0.866	RIPR2_MOUSE Rho family-interacting cell polarization regulator 2 OS=Mus musculus OX=10090 GN=Ripor2 PE=1 SV=2
5	Q9Y4F9	0.0	2200	1068	1.000	1.000	RIPR2_HUMAN Rho family-interacting cell polarization regulator 2 OS=Homo sapiens OX=9606 GN=RIPOR2 PE=1 SV=4
6	Q68FE6	2.71e-137	447	1223	0.197	0.172	RIPR1_MOUSE Rho family-interacting cell polarization regulator 1 OS=Mus musculus OX=10090 GN=Ripor1 PE=1 SV=2
7	Q6ZS17	1.31e-132	434	1223	0.194	0.169	RIPR1_HUMAN Rho family-interacting cell polarization regulator 1 OS=Homo sapiens OX=9606 GN=RIPOR1 PE=1 SV=1
8	Q96MK2	1.14e-109	365	946	0.181	0.204	RIPR3_HUMAN RIPOR family member 3 OS=Homo sapiens OX=9606 GN=RIPOR3 PE=1 SV=4
9	Q8NDB2	0.34	37.4	785	0.031	0.042	BANK1_HUMAN B-cell scaffold protein with ankyrin repeats OS=Homo sapiens OX=9606 GN=BANK1 PE=1 SV=3
10	P05129	0.80	36.2	697	0.037	0.057	KPCG_HUMAN Protein kinase C gamma type OS=Homo sapiens OX=9606 GN=PRKCG PE=1 SV=3
11	A0PJ31	2.2	34.7	523	0.041	0.084	A0PJ31_DANRE Cytochrome P450 CYP1C1 OS=Danio rerio OX=7955 GN=zgc:110607 PE=2 SV=1
12	C8BLR5	5.8	32.7	223	0.018	0.085	C8BLR5_MELGA glutathione transferase OS=Meleagris gallopavo OX=9103 GN=GSTA3 PE=2 SV=1
13	D4N2R6	5.8	32.7	223	0.018	0.085	D4N2R6_MELGA glutathione transferase OS=Meleagris gallopavo OX=9103 GN=tGSTA3 PE=2 SV=1
14	F4IXW2	7.5	33.1	1739	0.027	0.017	BIG5_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 5 OS=Arabidopsis thaliana OX=3702 GN=BIG5 PE=1 SV=2
15	P63318	9.8	32.7	697	0.038	0.059	KPCG_MOUSE Protein kinase C gamma type OS=Mus musculus OX=10090 GN=Prkcg PE=1 SV=1
16	P63319	9.8	32.7	697	0.038	0.059	KPCG_RAT Protein kinase C gamma type OS=Rattus norvegicus OX=10116 GN=Prkcg PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15665 FAM184	1.3e+02	13.7	Family with sequence similarity 184, A and B
2	PF02686 Glu-tRNAGln	3.9	19.2	Glu-tRNAGln amidotransferase C subunit
3	PF13646 HEAT_2	2.8	19.7	HEAT repeats
4	PF15903 PL48	1e-176	598.7	Filopodia upregulated, FAM65

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482957

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.920	Transforming protein RhoA
2	9606.ENSP00000256509	0.827	Neural cell adhesion molecule L1-like protein
3	9606.ENSP00000386881	0.728	Dysferlin
4	9606.ENSP00000307674	0.683	Soluble calcium-activated nucleotidase 1
5	9606.ENSP00000387100	0.675	Taperin
6	9606.ENSP00000241651	0.607	Myogenin
7	9606.ENSP00000334061	0.592	Histone deacetylase 6
8	9606.ENSP00000482885	0.565	Phosphatidylinositol phosphatase PTPRQ
9	9606.ENSP00000367214	0.554	Glutaredoxin domain-containing cysteine-rich protein 2
10	9606.ENSP00000338864	0.547	RAS guanyl-releasing protein 2
11	9606.ENSP00000250003	0.537	Myoblast determination protein 1
12	9606.ENSP00000285735	0.530	Rho-related GTP-binding protein RhoC
13	9606.ENSP00000367359	0.520	Uncharacterized protein C6orf62
14	9606.ENSP00000367459	0.518	Dyslexia-associated protein KIAA0319
15	9606.ENSP00000344095	0.514	Tissue-resident T-cell transcription regulator protein ZNF683
16	9606.ENSP00000283228	0.507	Receptor-type tyrosine-protein phosphatase R

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0071889	0.962	14-3-3 protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0044087	0.978	regulation of cellular component biogenesis
GO:0051130	0.977	positive regulation of cellular component organization
GO:0051491	0.974	positive regulation of filopodium assembly
GO:0032501	0.968	multicellular organismal process
GO:0009966	0.966	regulation of signal transduction
GO:0050896	0.953	response to stimulus
GO:0048519	0.946	negative regulation of biological process
GO:0048523	0.930	negative regulation of cellular process
GO:0051716	0.917	cellular response to stimulus
GO:0040012	0.910	regulation of locomotion
GO:1902531	0.890	regulation of intracellular signal transduction
GO:0007600	0.879	sensory perception
GO:2000145	0.875	regulation of cell motility
GO:1901739	0.865	regulation of myoblast fusion
GO:0065009	0.856	regulation of molecular function
GO:0050954	0.846	sensory perception of mechanical stimulus
GO:0030334	0.837	regulation of cell migration
GO:0010033	0.832	response to organic substance
GO:1990868	0.786	response to chemokine
GO:0030155	0.746	regulation of cell adhesion
GO:0051056	0.746	regulation of small GTPase mediated signal transduction
GO:0032878	0.718	regulation of establishment or maintenance of cell polarity
GO:0070887	0.715	cellular response to chemical stimulus
GO:0045661	0.705	regulation of myoblast differentiation
GO:1990869	0.697	cellular response to chemokine
GO:0046578	0.685	regulation of Ras protein signal transduction
GO:0002682	0.682	regulation of immune system process
GO:2000114	0.672	regulation of establishment of cell polarity
GO:1902532	0.670	negative regulation of intracellular signal transduction
GO:0035023	0.660	regulation of Rho protein signal transduction
GO:0051058	0.660	negative regulation of small GTPase mediated signal transduction
GO:0002685	0.659	regulation of leukocyte migration
GO:0007605	0.632	sensory perception of sound
GO:0050790	0.597	regulation of catalytic activity
GO:0046580	0.531	negative regulation of Ras protein signal transduction
GO:0051098	0.503	regulation of binding
GO:0045597	0.488	positive regulation of cell differentiation
GO:0044093	0.457	positive regulation of molecular function
GO:0051336	0.406	regulation of hydrolase activity
GO:0051099	0.354	positive regulation of binding
GO:0043087	0.350	regulation of GTPase activity
GO:0032502	0.311	developmental process
GO:0071840	0.309	cellular component organization or biogenesis
GO:0051239	0.307	regulation of multicellular organismal process
GO:0007162	0.301	negative regulation of cell adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0005737	0.999	cytoplasm
GO:0120025	0.995	plasma membrane bounded cell projection
GO:0043229	0.979	intracellular organelle
GO:0098858	0.970	actin-based cell projection
GO:0043232	0.952	intracellular non-membrane-bounded organelle
GO:0043227	0.950	membrane-bounded organelle
GO:0016020	0.822	membrane
GO:0043231	0.796	intracellular membrane-bounded organelle
GO:0005829	0.790	cytosol
GO:0043005	0.560	neuron projection
GO:0005856	0.472	cytoskeleton
GO:0030175	0.395	filopodium
GO:0031981	0.368	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]