StarFunc result for job id Q9Y4G2

User Input

>input (1056 residues)
MLSVVENGLDPQAAIPVIKKKLVGSVKALQKQYVSLDTVVTSEDGDANTMCSALEAVFIH
GLHAKHIRAEAGGKRKKSAHQKPLPQPVFWPLLKAVTHKHIISELEHLTFVNTDVGRCRA
WLRLALNDGLMECYLKLLLQEQARLHEYYQPTALLRDAEEGEFLLSFLQGLTSLSFELSY
KSAILNEWTLTPLALSGLCPLSELDPLSTSGAELQRKESLDSISHSSGSEDIEVHHSGHK
IRRNQKLTASSLSLDTASSSQLSCSLNSDSCLLQENGSKSPDHCEEPMSCDSDLGTANAE
DSDRSLQEVLLEFSKAQVNSVPTNGLSQETEIPTPQASLSLHGLNTSTYLHCEAPAEPLP
AQAASGTQDGVHVQEPRPQAPSPLDLQQPVESTSGQQPSSTVSETAREVGQGNGLQKAQA
HDGAGLKLVVSSPTSPKNKSWISEDDFYRPSREQPLESASDHPIASYRGTPGSRPGLHRH
FSQEPRKNCSLGALDQACVPSPGRRQAQAAPSQGHKSFRVVHRRQMGLSNPFRGLMKLGT
VERRGAMGIWKELFCELSPLEFRLYLSNEEHTCVENCSLLRCESVGPAHSDGRFELVFSG
KKLALRASSQDEAEDWLDRVREALQKVRPQQEDEWVNVQYPDQPEEPPEAPQGCLSPSDL
LSEPAALQGTQFDWSSAQVPEPDAIKESLLYLYMDRTWMPYIFSLSLEALKCFRIRNNEK
MLSDSHGVETIRDILPDTSLGGPSFFKIITAKAVLKLQAGNAEEAALWRDLVRKVLASYL
ETAEEAVTLGGSLDENCQEVLKFATRENGFLLQYLVAIPMEKGLDSQGCFCAGCSRQIGF
SFVRPKLCAFSGLYYCDICHQDDASVIPARIIHNWDLTKRPICRQALKFLTQIRAQPLIN
LQMVNASLYEHVERMHLIGRRREQLKLLGDYLGLCRSGALKELSKRLNHRNYLLESPHRF
SVADLQQIADGVYEGFLKALIEFASQHVYHCDLCTQRGFICQICQHHDIIFPFEFDTTVR
CAECKTVFHQSCQAVVKKGCPRCARRRKYQEQNIFA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7TSI1	0.395	0.389	0.000	1074	0.838	0.824	Q7TSI1.pdb.gz	PKHM1_MOUSE Pleckstrin homology domain-containing family M member 1 OS=Mus musculus OX=10090 GN=Plekhm1 PE=1 SV=1
2	AFDB:Q9Y4G2	1.000	1.000	0.000	1056	1.000	1.000	Q9Y4G2.pdb.gz	PKHM1_HUMAN Pleckstrin homology domain-containing family M member 1 OS=Homo sapiens OX=9606 GN=PLEKHM1 PE=1 SV=3
3	AFDB:A0A140LH27	0.115	0.081	2.414E-10	1664	0.092	0.058	A0A140LH27.pdb.gz	A0A140LH27_DANRE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 isoform X1 OS=Danio rerio OX=7955 GN=arap3 PE=4 SV=1
4	AFDB:Q8IVE3	0.100	0.077	1.818E-7	1493	0.090	0.064	Q8IVE3.pdb.gz	PKHH2_HUMAN Pleckstrin homology domain-containing family H member 2 OS=Homo sapiens OX=9606 GN=PLEKHH2 PE=1 SV=2
5	AFDB:Q8C115	0.101	0.077	1.910E-7	1491	0.097	0.068	Q8C115.pdb.gz	PKHH2_MOUSE Pleckstrin homology domain-containing family H member 2 OS=Mus musculus OX=10090 GN=Plekhh2 PE=1 SV=3
6	PDB:3ljuX	0.084	0.227	1.300E-5	373	0.029	0.083	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
7	PDB:6xtbE	0.097	0.337	3.013E-5	235	0.021	0.094	6xtbE.pdb.gz
8	AFDB:Q99KW3	0.094	0.053	3.604E-5	2014	0.123	0.065	Q99KW3.pdb.gz	TARA_MOUSE TRIO and F-actin-binding protein OS=Mus musculus OX=10090 GN=Triobp PE=1 SV=3
9	AFDB:Q9VGI1	0.100	0.081	3.604E-5	1354	0.092	0.072	Q9VGI1.pdb.gz	Q9VGI1_DROME FI23955p1 OS=Drosophila melanogaster OX=7227 GN=prd1 PE=2 SV=1
10	AFDB:P38800	0.080	0.064	4.614E-5	1345	0.086	0.068	P38800.pdb.gz	LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAM4 PE=1 SV=1
11	AFDB:Q6ZNL6	0.092	0.068	5.352E-5	1462	0.103	0.075	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
12	AFDB:O74653	0.083	0.100	5.908E-5	871	0.088	0.107	O74653.pdb.gz	POB1_SCHPO Protein pob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pob1 PE=1 SV=1
13	PDB:4mk0A	0.083	0.136	2.652E-4	631	0.017	0.029	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
14	PDB:3uzsA	0.083	0.137	5.298E-4	609	0.022	0.038	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
15	PDB:3pvuA	0.084	0.143	5.849E-4	609	0.018	0.031	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
16	PDB:4iapA	0.071	0.283	1.007E-3	256	0.013	0.055	4iapA.pdb.gz
17	PDB:7c3mA	0.073	0.124	1.290E-3	577	0.028	0.052	7c3mA.pdb.gz
18	PDB:6hhgA	0.082	0.214	1.424E-3	386	0.020	0.054	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
19	PDB:7rx9A	0.087	0.207	1.823E-3	432	0.016	0.039	7rx9A.pdb.gz
20	PDB:7nkyO	0.063	0.139	2.115E-3	427	0.021	0.052	7nkyO.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7TSI1	0.0	1760	1074	0.835	0.821	PKHM1_MOUSE Pleckstrin homology domain-containing family M member 1 OS=Mus musculus OX=10090 GN=Plekhm1 PE=1 SV=1
2	Q9Y4G2	0.0	2180	1056	1.000	1.000	PKHM1_HUMAN Pleckstrin homology domain-containing family M member 1 OS=Homo sapiens OX=9606 GN=PLEKHM1 PE=1 SV=3
3	Q8BM47	4.60e-74	263	761	0.169	0.234	PKHM3_MOUSE Pleckstrin homology domain-containing family M member 3 OS=Mus musculus OX=10090 GN=Plekhm3 PE=1 SV=1
4	K8ESM7	3.32e-41	166	955	0.086	0.095	K8ESM7_CAEEL RUN domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cup-14 PE=1 SV=1
5	Q6ZN54	1.75e-40	159	512	0.076	0.156	DEFI8_HUMAN Differentially expressed in FDCP 8 homolog OS=Homo sapiens OX=9606 GN=DEF8 PE=1 SV=2
6	Q99J78	1.65e-39	155	448	0.073	0.172	DEFI8_MOUSE Differentially expressed in FDCP 8 OS=Mus musculus OX=10090 GN=Def8 PE=1 SV=1
7	Q9H714	4.85e-39	157	662	0.094	0.150	PACER_HUMAN Protein associated with UVRAG as autophagy enhancer OS=Homo sapiens OX=9606 GN=RUBCNL PE=1 SV=3
8	Q80U62	4.55e-32	137	956	0.073	0.081	RUBIC_MOUSE Run domain Beclin-1-interacting and cysteine-rich domain-containing protein OS=Mus musculus OX=10090 GN=Rubcn PE=1 SV=2
9	Q92622	3.54e-31	134	972	0.073	0.079	RUBIC_HUMAN Run domain Beclin-1-interacting and cysteine-rich domain-containing protein OS=Homo sapiens OX=9606 GN=RUBCN PE=1 SV=4
10	H0Y6E6	3.99e-31	134	934	0.073	0.082	H0Y6E6_HUMAN Rubicon autophagy regulator (Fragment) OS=Homo sapiens OX=9606 GN=RUBCN PE=1 SV=1
11	Q3TD16	8.33e-28	122	648	0.079	0.128	PACER_MOUSE Protein associated with UVRAG as autophagy enhancer OS=Mus musculus OX=10090 GN=Rubcnl PE=1 SV=2
12	Q38BR7	6.35e-12	72.0	541	0.029	0.057	Q38BR7_TRYB2 Rubicon Homology domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4140 PE=4 SV=1
13	Q8IWE5	2.81e-11	70.5	1019	0.033	0.034	PKHM2_HUMAN Pleckstrin homology domain-containing family M member 2 OS=Homo sapiens OX=9606 GN=PLEKHM2 PE=1 SV=2
14	A0A0B4LHR2	2.69e-07	57.4	815	0.033	0.043	A0A0B4LHR2_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=CG6001 PE=4 SV=1
15	A0A126GV26	2.76e-07	57.0	700	0.033	0.050	A0A126GV26_DROME Uncharacterized protein, isoform H OS=Drosophila melanogaster OX=7227 GN=Dmel\CG31064 PE=4 SV=1
16	Q8IMP0	2.96e-07	57.0	862	0.033	0.041	Q8IMP0_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=RUFY1 PE=4 SV=1
17	Q8IMP1	3.07e-07	57.0	667	0.033	0.052	Q8IMP1_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=CG14261 PE=1 SV=1
18	A0A0B4LHR8	3.41e-07	57.0	877	0.033	0.040	A0A0B4LHR8_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG14261 PE=1 SV=1
19	Q8IMP2	3.70e-07	56.6	729	0.033	0.048	Q8IMP2_DROME LD28220p OS=Drosophila melanogaster OX=7227 GN=CG14261 PE=1 SV=1
20	Q961F7	3.82e-07	56.6	587	0.033	0.060	Q961F7_DROME GH26613p OS=Drosophila melanogaster OX=7227 GN=CG6001 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19769 CPxCG_zf	7.6e+02	11.3	CPxCG-related zinc finger
2	PF09845 DUF2072	1.9e+02	13.7	Zn-ribbon containing protein
3	PF00169 PH	0.062	25.2	PH domain
4	PF14446 Prok-RING_1	5.9e+02	11.8	Prokaryotic RING finger family 1
5	PF02759 RUN	2.5e-23	94.1	RUN domain
6	PF13901 zf-RING_9	1.2e-63	226.3	Putative zinc-RING and/or ribbon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000389913

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265062	0.990	Ras-related protein Rab-7a
2	9606.ENSP00000349785	0.931	Microtubule-associated proteins 1A/1B light chain 3C
3	9606.ENSP00000306866	0.929	Gamma-aminobutyric acid receptor-associated protein
4	9606.ENSP00000256496	0.843	ADP-ribosylation factor-like protein 8B
5	9606.ENSP00000479762	0.828	Ras-related protein Rab-7b
6	9606.ENSP00000395474	0.741	Sorting nexin-10
7	9606.ENSP00000193322	0.726	Osteopetrosis-associated transmembrane protein 1
8	9606.ENSP00000335193	0.697	Vam6/Vps39-like protein
9	9606.ENSP00000372193	0.689	H(+)/Cl(-) exchange transporter 7
10	9606.ENSP00000250124	0.687	Mannose-P-dolichol utilization defect 1 protein
11	9606.ENSP00000215730	0.684	Synaptosomal-associated protein 29
12	9606.ENSP00000259400	0.673	Syntaxin-17
13	9606.ENSP00000265686	0.672	V-type proton ATPase 116 kDa subunit a isoform 3
14	9606.ENSP00000366487	0.665	ADP-ribosylation factor-like protein 5B
15	9606.ENSP00000037243	0.635	Gamma-aminobutyric acid receptor-associated protein-like 2
16	9606.ENSP00000296137	0.635	FYVE and coiled-coil domain-containing protein 1
17	9606.ENSP00000285379	0.634	Carbonic anhydrase 2
18	9606.ENSP00000266458	0.631	Gamma-aminobutyric acid receptor-associated protein-like 1
19	9606.ENSP00000263080	0.584	Aspartoacylase
20	9606.ENSP00000403323	0.582	Rho GTPase-activating protein 27

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0008152	0.986	metabolic process
GO:0051179	0.983	localization
GO:0006996	0.977	organelle organization
GO:0061919	0.973	process utilizing autophagic mechanism
GO:0044237	0.966	cellular metabolic process
GO:0051640	0.965	organelle localization
GO:0051641	0.952	cellular localization
GO:1990849	0.951	vacuolar localization
GO:0050789	0.948	regulation of biological process
GO:0009056	0.945	catabolic process
GO:0006914	0.939	autophagy
GO:0006810	0.925	transport
GO:0046907	0.918	intracellular transport
GO:0050794	0.897	regulation of cellular process
GO:0016236	0.896	macroautophagy
GO:0016192	0.882	vesicle-mediated transport
GO:0032418	0.875	lysosome localization
GO:0048284	0.840	organelle fusion
GO:0061025	0.811	membrane fusion
GO:0016050	0.769	vesicle organization
GO:0090174	0.710	organelle membrane fusion
GO:0007041	0.608	lysosomal transport
GO:0048518	0.542	positive regulation of biological process
GO:0048522	0.489	positive regulation of cellular process
GO:0006906	0.380	vesicle fusion
GO:0019222	0.342	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005776	0.999	autophagosome
GO:0031981	0.999	nuclear lumen
GO:0005764	0.997	lysosome
GO:0005767	0.986	secondary lysosome
GO:0005730	0.983	nucleolus
GO:0044754	0.981	autolysosome
GO:0016020	0.974	membrane
GO:0005829	0.947	cytosol
GO:0012505	0.906	endomembrane system
GO:0031090	0.890	organelle membrane
GO:0031982	0.827	vesicle
GO:0098588	0.814	bounding membrane of organelle
GO:0031410	0.627	cytoplasmic vesicle
GO:0005654	0.419	nucleoplasm
GO:0005774	0.379	vacuolar membrane
GO:0005765	0.341	lysosomal membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]