StarFunc result for job id Q9Y4G6

User Input

>input (2542 residues)
MVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSR
IGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEF
GGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRTGKAEHGSVALPAVMRSGSSGPETFNVGSMPSPQQQVMV
GQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVD
ESKHEIHSQVDAITAGTASVVNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLAAL
MDDEVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGDLLRQIGE
NETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLV
ACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATTDSELLKQVSAAASVVSQA
LHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLV
NAMRSDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGL
RVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAVSNKNPAAQQQLVQSCKA
VADHIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAM
QLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNTVQTLKNELQDAKMAAVESQLKP
LPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAARGV
AASTTDPAAAHAMLDSARDVMEGSAMLIQEAKQALIAPGDAERQQRLAQVAKAVSHSLNN
CVNCLPGQKDVDVALKSIGESSKKLLVDSLPPSTKPFQEAQSELNQAAADLNQSAGEVVH
ATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLA
AKSLSVDPGAPNAKNLLAAAARAVTESINQLITLCTQQAPGQKECDNALRELETVKGMLD
NPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTE
AAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGSSPSQVLSAATIV
AKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKC
RIATAPLIEAVENLTAFASNPEFVSIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTAR
SLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQA
SLAAVSQSLATRDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYF
EPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEA
AQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVK
YSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGHLAFQGQMAAATAEPEEIGFQIRTR
VQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACI
TAATAVSGIIADLDTTIMFATAGTLNAENSETFADHRENILKTAKALVEDTKLLVSGAAS
TPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALSDLISATK
GAASKPVDDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTV
FQSKDVPEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTAC
KQASFHPDVSDEVRTRALRFGTECTLGYLDLLEHVLVILQKPTPEFKQQLAAFSKRVAGA
VTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETL
DFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARM
VAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAA
GNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARK
KLAQIRQQQYKFLPTELREDEG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6r9tA	0.838	0.973	0.000	2185	0.650	0.756	6r9tA.pdb.gz
2	AFDB:A0A0R4IDZ8	0.977	0.977	0.000	2544	0.767	0.766	A0A0R4IDZ8.pdb.gz
3	AFDB:A0A3G2LGI8	0.571	0.573	0.000	2531	0.529	0.531	A0A3G2LGI8.pdb.gz	TLN_OSCPE Talin OS=Oscarella pearsei OX=1940113 GN=TLN PE=1 SV=1
4	AFDB:G3V852	0.936	0.937	0.000	2541	0.761	0.762	G3V852.pdb.gz	G3V852_RAT Talin 1 OS=Rattus norvegicus OX=10116 GN=Tln1 PE=1 SV=1
5	AFDB:G5EGK1	0.538	0.536	0.000	2553	0.380	0.378	G5EGK1.pdb.gz	G5EGK1_CAEEL FERM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tln-1 PE=1 SV=1
6	AFDB:P54939	0.950	0.951	0.000	2541	0.779	0.780	P54939.pdb.gz	TLN1_CHICK Talin-1 OS=Gallus gallus OX=9031 GN=TLN1 PE=1 SV=2
7	AFDB:Q71LX4	0.327	0.347	0.000	2375	0.913	0.977	Q71LX4.pdb.gz	TLN2_MOUSE Talin-2 OS=Mus musculus OX=10090 GN=Tln2 PE=1 SV=3
8	AFDB:Q9Y4G6	1.000	1.000	0.000	2542	1.000	1.000	Q9Y4G6.pdb.gz	TLN2_HUMAN Talin-2 OS=Homo sapiens OX=9606 GN=TLN2 PE=1 SV=4
9	AFDB:Q54K81	0.139	0.136	3.329E-100	2614	0.258	0.251	Q54K81.pdb.gz	TALB_DICDI Talin-B OS=Dictyostelium discoideum OX=44689 GN=talB PE=2 SV=1
10	AFDB:P0CE95	0.143	0.146	2.934E-92	2492	0.228	0.233	P0CE95.pdb.gz	TALA1_DICDI Talin-A OS=Dictyostelium discoideum OX=44689 GN=talA PE=1 SV=1
11	AFDB:M9PF06	0.152	0.647	3.495E-42	513	0.117	0.579	M9PF06.pdb.gz	M9PF06_DROME Rhea, isoform I OS=Drosophila melanogaster OX=7227 GN=rhea PE=1 SV=1
12	PDB:7c3mA	0.118	0.448	7.065E-12	577	0.038	0.166	7c3mA.pdb.gz
13	PDB:4rm8A	0.097	0.528	2.560E-10	368	0.022	0.155	4rm8A.pdb.gz
14	PDB:6xz4A	0.100	0.593	5.932E-10	304	0.027	0.224	6xz4A.pdb.gz
15	PDB:1tr2B	0.071	0.124	6.436E-7	1029	0.062	0.153	1tr2B.pdb.gz
16	PDB:4iggB	0.061	0.137	1.280E-6	771	0.038	0.126	4iggB.pdb.gz
17	PDB:6bfiB	0.057	0.142	5.897E-6	806	0.041	0.128	6bfiB.pdb.gz
18	PDB:6nr7A	0.070	0.133	6.871E-6	1086	0.059	0.139	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
19	PDB:6fuyA	0.065	0.121	1.007E-5	961	0.052	0.137	6fuyA.pdb.gz
20	PDB:6yvaC	0.043	0.432	2.823E-5	155	0.010	0.161	6yvaC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A3G2LGI8	2398	2531	0.531	0.533	TLN_OSCPE Talin OS=Oscarella pearsei OX=1940113 GN=TLN PE=1 SV=1
2	A0A8I6ABG6	3884	2558	0.762	0.758	A0A8I6ABG6_RAT Talin 1 OS=Rattus norvegicus OX=10116 GN=Tln1 PE=1 SV=1
3	G3V852	3893	2541	0.762	0.763	G3V852_RAT Talin 1 OS=Rattus norvegicus OX=10116 GN=Tln1 PE=1 SV=1
4	G4S9F5	937	1890	0.266	0.358	G4S9F5_CAEEL I/LWEQ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tln-1 PE=1 SV=1
5	G5EGK1	1537	2553	0.393	0.391	G5EGK1_CAEEL FERM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tln-1 PE=1 SV=1
6	M9NDM3	1905	2169	0.391	0.459	M9NDM3_DROME Rhea, isoform C OS=Drosophila melanogaster OX=7227 GN=rhea PE=1 SV=1
7	M9PBW9	2237	2815	0.477	0.431	M9PBW9_DROME Rhea, isoform G OS=Drosophila melanogaster OX=7227 GN=rhea PE=1 SV=1
8	M9PEJ8	2253	2689	0.479	0.453	M9PEJ8_DROME Rhea, isoform H OS=Drosophila melanogaster OX=7227 GN=rhea PE=1 SV=1
9	M9PF06	638	513	0.117	0.581	M9PF06_DROME Rhea, isoform I OS=Drosophila melanogaster OX=7227 GN=rhea PE=1 SV=1
10	P26039	3897	2541	0.760	0.760	TLN1_MOUSE Talin-1 OS=Mus musculus OX=10090 GN=Tln1 PE=1 SV=2
11	P54939	3960	2541	0.780	0.780	TLN1_CHICK Talin-1 OS=Gallus gallus OX=9031 GN=TLN1 PE=1 SV=2
12	Q3B7U7	629	386	0.127	0.837	Q3B7U7_RAT Tln1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Tln1 PE=2 SV=1
13	Q498D4	2180	1552	0.435	0.713	Q498D4_RAT Tln1 protein OS=Rattus norvegicus OX=10116 GN=Tln1 PE=2 SV=1
14	Q54K81	706	2614	0.271	0.264	TALB_DICDI Talin-B OS=Dictyostelium discoideum OX=44689 GN=talB PE=2 SV=1
15	Q5U7N6	3920	2538	0.767	0.768	Q5U7N6_DANRE Talin-1 OS=Danio rerio OX=7955 GN=sb:cb854 PE=1 SV=1
16	Q71LX4	4754	2375	0.921	0.986	TLN2_MOUSE Talin-2 OS=Mus musculus OX=10090 GN=Tln2 PE=1 SV=3
17	Q95XN3	709	996	0.162	0.413	Q95XN3_CAEEL FERM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tln-1 PE=1 SV=1
18	Q960C2	1091	1601	0.241	0.382	Q960C2_DROME SD07967p OS=Drosophila melanogaster OX=7227 GN=rhea PE=2 SV=1
19	Q9VSL8	2251	2836	0.479	0.429	Q9VSL8_DROME Rhea, isoform B OS=Drosophila melanogaster OX=7227 GN=rhea PE=1 SV=1
20	Q9Y490	3914	2541	0.762	0.762	TLN1_HUMAN Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00887 ACBP	8.2	18.2	Acyl CoA binding protein
2	PF16511 FERM_f0	2.1e-34	129.0	N-terminal or F0 domain of Talin-head FERM
3	PF00373 FERM_M	2.4e-20	84.4	FERM central domain
4	PF09379 FERM_N	0.034	25.3	FERM N-terminal domain
5	PF12205 GIT1_C	1e+02	14.5	G protein-coupled receptor kinase-interacting protein 1 C term
6	PF02174 IRS	1.5	20.1	PTB domain (IRS-1 type)
7	PF01608 I_LWEQ	1.4e-60	215.2	I/LWEQ domain
8	PF09141 Talin_middle	4.9e-56	200.7	Talin, middle domain
9	PF06242 TrcR	4.1e+02	12.4	Transcriptional cell cycle regulator TrcR
10	PF00240 ubiquitin	2.9e+02	12.6	Ubiquitin family
11	PF08913 VBS	2.5e-68	239.7	Vinculin Binding Site

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000453508

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000211998	0.993	Vinculin
2	9606.ENSP00000365411	0.978	Amyloid beta A4 precursor protein-binding family B member 1-interacting protein
3	9606.ENSP00000452786	0.938	Integrin beta-3
4	9606.ENSP00000379350	0.931	Integrin beta-1
5	9606.ENSP00000341189	0.907	Focal adhesion kinase 1
6	9606.ENSP00000293379	0.902	Integrin alpha-5
7	9606.ENSP00000295006	0.867	Calpain-2 catalytic subunit
8	9606.ENSP00000362680	0.862	Proto-oncogene tyrosine-protein kinase Src
9	9606.ENSP00000466363	0.861	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
10	9606.ENSP00000349960	0.847	Actin, cytoplasmic 1
11	9606.ENSP00000458162	0.835	Actin, cytoplasmic 2
12	9606.ENSP00000262407	0.828	Integrin alpha-IIb
13	9606.ENSP00000222573	0.820	Integrin beta-8
14	9606.ENSP00000316029	0.803	Talin-1
15	9606.ENSP00000283249	0.798	Integrin beta-6
16	9606.ENSP00000296181	0.794	Integrin beta-5
17	9606.ENSP00000267082	0.787	Integrin beta-7
18	9606.ENSP00000261023	0.780	Integrin alpha-V
19	9606.ENSP00000264741	0.771	Integrin alpha-9
20	9606.ENSP00000452120	0.758	Integrin alpha-7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050839	0.995	cell adhesion molecule binding
GO:0044877	0.994	protein-containing complex binding
GO:0005102	0.991	signaling receptor binding
GO:0005178	0.983	integrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0044085	0.989	cellular component biogenesis
GO:0016043	0.986	cellular component organization
GO:0048856	0.969	anatomical structure development
GO:0022607	0.969	cellular component assembly
GO:0032501	0.957	multicellular organismal process
GO:0034330	0.947	cell junction organization
GO:0065007	0.905	biological regulation
GO:0050789	0.823	regulation of biological process
GO:0050794	0.812	regulation of cellular process
GO:0048513	0.784	animal organ development
GO:0007275	0.748	multicellular organism development
GO:0045216	0.736	cell-cell junction organization
GO:0006996	0.731	organelle organization
GO:0034329	0.660	cell junction assembly
GO:0009888	0.652	tissue development
GO:0009653	0.647	anatomical structure morphogenesis
GO:0050896	0.616	response to stimulus
GO:0007010	0.598	cytoskeleton organization
GO:0007155	0.560	cell adhesion
GO:0048869	0.553	cellular developmental process
GO:0030036	0.527	actin cytoskeleton organization
GO:0030154	0.519	cell differentiation
GO:0048646	0.426	anatomical structure formation involved in morphogenesis
GO:0051716	0.371	cellular response to stimulus
GO:0098609	0.346	cell-cell adhesion
GO:0048598	0.329	embryonic morphogenesis
GO:0097435	0.320	supramolecular fiber organization
GO:0061061	0.318	muscle structure development
GO:0007154	0.309	cell communication
GO:0048731	0.308	system development
GO:0007043	0.308	cell-cell junction assembly
GO:0060429	0.305	epithelium development
GO:0023052	0.300	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005925	0.999	focal adhesion
GO:0005829	0.867	cytosol
GO:0043226	0.823	organelle
GO:0005886	0.716	plasma membrane
GO:0043227	0.699	membrane-bounded organelle
GO:0043229	0.532	intracellular organelle
GO:0043231	0.404	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]