StarFunc result for job id Q9Y4G8

User Input

>input (1499 residues)
MKPLAIPANHGVMGQQEKHSLPADFTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSSSLS
DIYQATESEAGDMDLSGLPETAVDSEDDDDEEDIERASDPLMSRDIVRDCLEKDPIDRTD
DDIEQLLEFMHQLPAFANMTMSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGS
VEVTYPDGKAEILCMGNSFGVSPTMDKEYMKGVMRTKVDDCQFVCIAQQDYCRILNQVEK
NMQKVEEEGEIVMVKEHRELDRTGTRKGHIVIKGTSERLTMHLVEEHSVVDPTFIEDFLL
TYRTFLSSPMEVGKKLLEWFNDPSLRDKVTRVVLLWVNNHFNDFEGDPAMTRFLEEFENN
LEREKMGGHLRLLNIACAAKAKRRLMTLTKPSREAPLPFILLGGSEKGFGIFVDSVDSGS
KATEAGLKRGDQILEVNGQNFENIQLSKAMEILRNNTHLSITVKTNLFVFKELLTRLSEE
KRNGAPHLPKIGDIKKASRYSIPDLAVDVEQVIGLEKVNKKSKANTVGGRNKLKKILDKT
RISILPQKPYNDIGIGQSQDDSIVGLRQTKHIPTALPVSGTLSSSNPDLLQSHHRILDFS
ATPDLPDQVLRVFKADQQSRYIMISKDTTAKEVVIQAIREFAVTATPDQYSLCEVSVTPE
GVIKQRRLPDQLSKLADRIQLSGRYYLKNNMETETLCSDEDAQELLRESQISLLQLSTVE
VATQLSMRNFELFRNIEPTEYIDDLFKLRSKTSCANLKRFEEVINQETFWVASEILRETN
QLKRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLAPVARLRTTWEKLPNKYEKLFQDL
QDLFDPSRNMAKYRNVLNSQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDGLVNFEKLRMI
AKEIRHVGRMASVNMDPALMFRTRKKKWRSLGSLSQGSTNATVLDVAQTGGHKKRVRRSS
FLNAKKLYEDAQMARKVKQYLSNLELEMDEESLQTLSLQCEPATNTLPKNPGDKKPVKSE
TSPVAPRAGSQQKAQSLPQPQQQPPPAHKINQGLQVPAVSLYPSRKKVPVKDLPPFGINS
PQALKKILSLSEEGSLERHKKQAEDTISNASSQLSSPPTSPQSSPRKGYTLAPSGTVDNF
SDSGHSEISSRSSIVSNSSFDSVPVSLHDERRQRHSVSIVETNLGMGRMERRTMIEPDQY
SLGSYAPMSEGRGLYATATVISSPSTEELSQDQGDRASLDAADSGRGSWTSCSSGSHDNI
QTIQHQRSWETLPFGHTHFDYSGDPAGLWASSSHMDQIMFSDHSTKYNRQNQSRESLEQA
QSRASWASSTGYWGEDSEGDTGTIKRRGGKDVSIEAESSSLTSVTTEETKPVPMPAHIAV
ASSTTKGLIARKEGRYREPPPTPPGYIGIPITDFPEGHSHPARKPPDYNVALQRSRMVAR
SSDTAGPSSVQQPHGHPTSSRPVNKPQWHKPNESDPRLAPYQSQGFSTEEDEDEQVSAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TEU7	0.548	0.516	0.000	1601	0.637	0.597	Q8TEU7.pdb.gz	RPGF6_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=RAPGEF6 PE=1 SV=2
2	AFDB:Q9Y4G8	1.000	1.000	0.000	1499	1.000	1.000	Q9Y4G8.pdb.gz	RPGF2_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1
3	AFDB:Q9VMF3	0.495	0.473	6.779E-89	1573	0.376	0.359	Q9VMF3.pdb.gz	Q9VMF3_DROME Dizzy isoform AII OS=Drosophila melanogaster OX=7227 GN=PDZ-GEF PE=1 SV=2
4	AFDB:G5EDB9	0.502	0.511	3.225E-78	1470	0.291	0.297	G5EDB9.pdb.gz	RPGF_CAEEL Rap guanine nucleotide exchange factor OS=Caenorhabditis elegans OX=6239 GN=pxf-1 PE=1 SV=1
5	PDB:4f7zA	0.304	0.470	8.228E-32	946	0.129	0.204	4f7zA.pdb.gz
6	PDB:2byvE	0.315	0.503	2.511E-31	922	0.120	0.195	2byvE.pdb.gz
7	AFDB:P26675	0.220	0.207	4.350E-13	1596	0.139	0.131	P26675.pdb.gz	SOS_DROME Protein son of sevenless OS=Drosophila melanogaster OX=7227 GN=Sos PE=1 SV=2
8	AFDB:Q9N5D3	0.216	0.217	5.535E-12	1493	0.126	0.127	Q9N5D3.pdb.gz	SOS_CAEEL Son of sevenless homolog OS=Caenorhabditis elegans OX=6239 GN=sos-1 PE=1 SV=3
9	AFDB:Q5SYB0	0.056	0.056	1.476E-6	1578	0.122	0.116	Q5SYB0.pdb.gz	FRPD1_HUMAN FERM and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FRMPD1 PE=1 SV=1
10	AFDB:D4A3K7	0.059	0.054	2.109E-6	1705	0.114	0.100	D4A3K7.pdb.gz	D4A3K7_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=2
11	AFDB:Q5JV73	0.061	0.054	3.766E-6	1810	0.123	0.102	Q5JV73.pdb.gz	FRPD3_HUMAN FERM and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FRMPD3 PE=2 SV=2
12	AFDB:Q14CM0	0.062	0.069	3.938E-6	1322	0.118	0.134	Q14CM0.pdb.gz	FRPD4_HUMAN FERM and PDZ domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FRMPD4 PE=1 SV=1
13	PDB:6byrB	0.075	0.341	1.556E-5	288	0.030	0.156	6byrB.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
14	PDB:5dykA	0.071	0.124	1.779E-5	809	0.023	0.043	5dykA.pdb.gz
15	PDB:3j4qB	0.076	0.266	2.127E-5	382	0.022	0.086	3j4qB.pdb.gz
16	PDB:4dinB	0.071	0.279	4.965E-5	345	0.033	0.145	4dinB.pdb.gz	Localization and quaternary structure of the PKA RI Beta holoenzyme
17	PDB:3dkwA	0.068	0.388	1.584E-4	227	0.016	0.106	3dkwA.pdb.gz
18	PDB:4avaA	0.064	0.266	1.894E-4	327	0.023	0.107	4avaA.pdb.gz	Cyclic AMP Regulation of Protein Lysine Acetylation in Mycobacterium Tuberculosis.
19	PDB:7ff0A	0.062	0.400	2.070E-4	206	0.013	0.097	7ff0A.pdb.gz	Inhibitory mechanism of gold analogues against Pseudomonas global virulence factor regulator Vfr
20	PDB:4ev0D	0.066	0.410	2.264E-4	214	0.012	0.084	4ev0D.pdb.gz	Crystal Structure of T. thermophilius Catabolite Activator Protein

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y661	0.0	3031	1559	0.982	0.944	A0A2R8Y661_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1
2	A0A2R8YGD3	0.0	3054	1679	0.987	0.881	A0A2R8YGD3_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1
3	A0A5F9ZHG7	0.0	1441	1267	0.538	0.637	A0A5F9ZHG7_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=RAPGEF6 PE=4 SV=1
4	E9PCH4	0.0	1719	1651	0.638	0.580	E9PCH4_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 PE=4 SV=1
5	F1M386	0.0	2806	1496	0.947	0.949	RPGF2_RAT Rap guanine nucleotide exchange factor 2 OS=Rattus norvegicus OX=10116 GN=Rapgef2 PE=1 SV=2
6	F1MSG6	0.0	2770	1486	0.936	0.944	RPGF2_BOVIN Rap guanine nucleotide exchange factor 2 OS=Bos taurus OX=9913 GN=RAPGEF2 PE=1 SV=2
7	F1PBJ0	0.0	3056	1498	0.981	0.982	RPGF2_CANLF Rap guanine nucleotide exchange factor 2 OS=Canis lupus familiaris OX=9615 GN=RAPGEF2 PE=1 SV=2
8	G5ECB8	0.0	650	1146	0.270	0.353	G5ECB8_CAEEL Rap guanine nucleotide exchange factor 2 OS=Caenorhabditis elegans OX=6239 GN=pxf-1 PE=1 SV=1
9	G5ECE2	0.0	650	1188	0.252	0.317	G5ECE2_CAEEL Rap guanine nucleotide exchange factor 2 OS=Caenorhabditis elegans OX=6239 GN=pxf-1 PE=1 SV=1
10	G5EDB9	0.0	652	1470	0.252	0.256	RPGF_CAEEL Rap guanine nucleotide exchange factor OS=Caenorhabditis elegans OX=6239 GN=pxf-1 PE=1 SV=1
11	G5EEE0	0.0	652	1305	0.252	0.289	G5EEE0_CAEEL Rap guanine nucleotide exchange factor 2 OS=Caenorhabditis elegans OX=6239 GN=pxf-1 PE=1 SV=1
12	Q17RH5	0.0	3080	1486	0.991	1.000	Q17RH5_HUMAN RAPGEF2 protein OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1
13	Q8CHG7	0.0	2807	1496	0.948	0.950	RPGF2_MOUSE Rap guanine nucleotide exchange factor 2 OS=Mus musculus OX=10090 GN=Rapgef2 PE=1 SV=2
14	Q8TEU7	0.0	1720	1601	0.638	0.598	RPGF6_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=RAPGEF6 PE=1 SV=2
15	Q9Y4G8	0.0	3108	1499	1.000	1.000	RPGF2_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1
16	B7Z026	3.18e-144	480	1422	0.165	0.174	B7Z026_DROME Dizzy isoform CII OS=Drosophila melanogaster OX=7227 GN=PDZ-GEF PE=1 SV=1
17	Q9VMF3	9.69e-144	482	1573	0.165	0.157	Q9VMF3_DROME Dizzy isoform AII OS=Drosophila melanogaster OX=7227 GN=PDZ-GEF PE=1 SV=2
18	Q95V18	1.15e-143	482	1573	0.165	0.157	Q95V18_DROME Guanine nucleotide exchange factor OS=Drosophila melanogaster OX=7227 GN=PDZ-GEF PE=2 SV=1
19	B7Z025	2.21e-143	481	1569	0.165	0.157	B7Z025_DROME Dizzy isoform BII OS=Drosophila melanogaster OX=7227 GN=PDZ-GEF PE=1 SV=1
20	Q7K3Z6	5.14e-44	176	861	0.067	0.116	Q7K3Z6_DROME Exchange protein directly activated by cAMP, isoform D OS=Drosophila melanogaster OX=7227 GN=Epac PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00027 cNMP_binding	1.1	20.7	Cyclic nucleotide-binding domain
2	PF00595 PDZ	1.4e-07	43.1	PDZ domain
3	PF13180 PDZ_2	2.8	19.7	PDZ domain
4	PF17820 PDZ_6	3e-06	38.3	PDZ domain
5	PF02163 Peptidase_M50	0.0014	29.6	Peptidase family M50
6	PF00788 RA	4.9e-08	44.8	Ras association (RalGDS/AF-6) domain
7	PF00617 RasGEF	4.3e-50	181.9	RasGEF domain
8	PF00618 RasGEF_N	4.6e-09	47.8	RasGEF N-terminal motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264431

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358723	0.992	Ras-related protein Rap-1A
2	9606.ENSP00000344456	0.982	Catenin beta-1
3	9606.ENSP00000385450	0.972	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
4	9606.ENSP00000250559	0.961	Ras-related protein Rap-1b
5	9606.ENSP00000289104	0.934	Ras-related protein M-Ras
6	9606.ENSP00000346151	0.924	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
7	9606.ENSP00000340274	0.922	Ras-related protein Rap-2c
8	9606.ENSP00000438262	0.910	Tight junction protein ZO-2
9	9606.ENSP00000281537	0.897	Tight junction protein ZO-1
10	9606.ENSP00000407586	0.897	GTPase HRas
11	9606.ENSP00000256196	0.872	Ras-related protein R-Ras2
12	9606.ENSP00000358548	0.863	GTPase NRas
13	9606.ENSP00000256078	0.859	GTPase KRas
14	9606.ENSP00000304604	0.851	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3
15	9606.ENSP00000246792	0.841	Ras-related protein R-Ras
16	9606.ENSP00000424827	0.821	E3 ubiquitin-protein ligase NEDD4
17	9606.ENSP00000319096	0.810	Ras-related protein Rap-2b
18	9606.ENSP00000296859	0.809	Rap guanine nucleotide exchange factor 6
19	9606.ENSP00000359206	0.751	F-box/WD repeat-containing protein 1A
20	9606.ENSP00000265094	0.735	F-box/WD repeat-containing protein 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.994	protein binding
GO:0005085	0.993	guanyl-nucleotide exchange factor activity
GO:0097367	0.979	carbohydrate derivative binding
GO:0043168	0.967	anion binding
GO:0030552	0.961	cAMP binding
GO:0019899	0.892	enzyme binding
GO:0070300	0.888	phosphatidic acid binding
GO:0005096	0.712	GTPase activator activity
GO:0005102	0.617	signaling receptor binding
GO:0031690	0.613	adrenergic receptor binding
GO:0019904	0.605	protein domain specific binding
GO:0030165	0.536	PDZ domain binding
GO:0050699	0.530	WW domain binding
GO:0031267	0.392	small GTPase binding
GO:0031697	0.304	beta-1 adrenergic receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0023052	0.978	signaling
GO:0050896	0.966	response to stimulus
GO:0043547	0.961	positive regulation of GTPase activity
GO:0051716	0.953	cellular response to stimulus
GO:0048518	0.953	positive regulation of biological process
GO:0070372	0.953	regulation of ERK1 and ERK2 cascade
GO:0007154	0.947	cell communication
GO:0009719	0.932	response to endogenous stimulus
GO:0031401	0.925	positive regulation of protein modification process
GO:0045860	0.918	positive regulation of protein kinase activity
GO:0032502	0.897	developmental process
GO:0043410	0.896	positive regulation of MAPK cascade
GO:0048856	0.894	anatomical structure development
GO:0007165	0.887	signal transduction
GO:0071495	0.880	cellular response to endogenous stimulus
GO:0071840	0.866	cellular component organization or biogenesis
GO:0016043	0.863	cellular component organization
GO:0051128	0.859	regulation of cellular component organization
GO:0070374	0.828	positive regulation of ERK1 and ERK2 cascade
GO:0032501	0.820	multicellular organismal process
GO:0048523	0.810	negative regulation of cellular process
GO:0120035	0.732	regulation of plasma membrane bounded cell projection organization
GO:0050793	0.694	regulation of developmental process
GO:0030154	0.686	cell differentiation
GO:0010975	0.643	regulation of neuron projection development
GO:0030030	0.619	cell projection organization
GO:0007186	0.587	G protein-coupled receptor signaling pathway
GO:0048468	0.572	cell development
GO:0042221	0.457	response to chemical
GO:0007275	0.450	multicellular organism development
GO:0008152	0.423	metabolic process
GO:0035556	0.404	intracellular signal transduction
GO:0120036	0.350	plasma membrane bounded cell projection organization
GO:0048731	0.350	system development
GO:0042127	0.328	regulation of cell population proliferation
GO:0051179	0.313	localization
GO:0051239	0.309	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.995	plasma membrane
GO:0005829	0.995	cytosol
GO:0043226	0.864	organelle
GO:0030054	0.862	cell junction
GO:0070161	0.852	anchoring junction
GO:0043229	0.825	intracellular organelle
GO:0043227	0.819	membrane-bounded organelle
GO:0043231	0.773	intracellular membrane-bounded organelle
GO:0005911	0.540	cell-cell junction
GO:0098590	0.400	plasma membrane region
GO:0070160	0.398	tight junction
GO:0048471	0.392	perinuclear region of cytoplasm
GO:0043296	0.386	apical junction complex
GO:0045177	0.374	apical part of cell
GO:0005923	0.368	bicellular tight junction
GO:0005768	0.367	endosome
GO:0030139	0.364	endocytic vesicle
GO:0005770	0.362	late endosome
GO:0016324	0.321	apical plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]