StarFunc result for job id Q9Y4H2

User Input

>input (1338 residues)
MASPPRHGPPGPASGDGPNLNNNNNNNNHSVRKCGYLRKQKHGHKRFFVLRGPGAGGDEA
TAGGGSAPQPPRLEYYESEKKWRSKAGAPKRVIALDCCLNINKRADAKHKYLIALYTKDE
YFAVAAENEQEQEGWYRALTDLVSEGRAAAGDAPPAAAPAASCSASLPGALGGSAGAAGA
EDSYGLVAPATAAYREVWQVNLKPKGLGQSKNLTGVYRLCLSARTIGFVKLNCEQPSVTL
QLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEF
RPRSKSQSSGSSATHPISVPGARRHHHLVNLPPSQTGLVRRSRTDSLAATPPAAKCSSCR
VRTASEGDGGAAAGAAAAGARPVSVAGSPLSPGPVRAPLSRSHTLSGGCGGRGSKVALLP
AGGALQHSRSMSMPVAHSPPAATSPGSLSSSSGHGSGSYPPPPGPHPPLPHPLHHGPGQR
PSSGSASASGSPSDPGFMSLDEYGSSPGDLRAFCSHRSNTPESIAETPPARDGGGGGEFY
GYMTMDRPLSHCGRSYRRVSGDAAQDLDRGLRKRTYSLTTPARQRPVPQPSSASLDEYTL
MRATFSGSAGRLCPSCPASSPKVAYHPYPEDYGDIEIGSHRSSSSNLGADDGYMPMTPGA
ALAGSGSGSCRSDDYMPMSPASVSAPKQILQPRAAAAAAAAVPSAGPAGPAPTSAAGRTF
PASGGGYKASSPAESSPEDSGYMRMWCGSKLSMEHADGKLLPNGDYLNVSPSDAVTTGTP
PDFFSAALHPGGEPLRGVPGCCYSSLPRSYKAPYTCGGDSDQYVLMSSPVGRILEEERLE
PQATPGPSQAASAFGAGPTQPPHPVVPSPVRPSGGRPEGFLGQRGRAVRPTRLSLEGLPS
LPSMHEYPLPPEPKSPGEYINIDFGEPGARLSPPAPPLLASAASSSSLLSASSPASSLGS
GTPGTSSDSRQRSPLSDYMNLDFSSPKSPKPGAPSGHPVGSLDGLLSPEASSPYPPLPPR
PSASPSSSLQPPPPPPAPGELYRLPPASAVATAQGPGAASSLSSDTGDNGDYTEMAFGVA
ATPPQPIAAPPKPEAARVASPTSGVKRLSLMEQVSGVEAFLQASQPPDPHRGAKVIRADP
QGGRRRHSSETFSSTTTVTPVSPSFAHNPKRHNSASVENVSLRKSSEGGVGVGPGGGDEP
PTSPRQLQPAPPLAPQGRPWTPGQPGGLVGCPGSGGSPMRRETSAGFQNGLNYIAIDVRE
EPGLPPQPQPPPPPLPQPGDKSSWGRTRSLGGLISAVGVGSTGGGCGGPGPGALPPANTY
ASIDFLSHHLKEATIVKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1MAL5	0.315	0.317	0.000	1327	0.862	0.870	F1MAL5.pdb.gz	F1MAL5_RAT Insulin receptor substrate 2 OS=Rattus norvegicus OX=10116 GN=Irs2 PE=1 SV=2
2	AFDB:Q9Y4H2	0.999	0.999	0.000	1338	1.000	1.000	Q9Y4H2.pdb.gz	IRS2_HUMAN Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2
3	AFDB:F1QHL0	0.204	0.259	1.183E-65	1032	0.456	0.591	F1QHL0.pdb.gz
4	AFDB:P35568	0.175	0.187	2.430E-52	1242	0.397	0.428	P35568.pdb.gz	IRS1_HUMAN Insulin receptor substrate 1 OS=Homo sapiens OX=9606 GN=IRS1 PE=1 SV=1
5	AFDB:Q9DF49	0.195	0.234	3.783E-52	1074	0.350	0.436	Q9DF49.pdb.gz	IRS2A_XENLA Insulin receptor substrate 2-A OS=Xenopus laevis OX=8355 GN=irs2-a PE=2 SV=2
6	AFDB:E7F4P8	0.186	0.220	4.466E-52	1099	0.377	0.460	E7F4P8.pdb.gz	E7F4P8_DANRE Insulin receptor substrate 1 OS=Danio rerio OX=7955 GN=irs1 PE=4 SV=1
7	AFDB:Q9Z0Y7	0.184	0.201	2.918E-33	1216	0.244	0.268	Q9Z0Y7.pdb.gz	IRS4_MOUSE Insulin receptor substrate 4 OS=Mus musculus OX=10090 GN=Irs4 PE=1 SV=2
8	AFDB:O14654	0.172	0.182	4.299E-33	1257	0.247	0.263	O14654.pdb.gz	IRS4_HUMAN Insulin receptor substrate 4 OS=Homo sapiens OX=9606 GN=IRS4 PE=1 SV=1
9	AFDB:Q9XTN2	0.170	0.229	1.351E-25	968	0.161	0.223	Q9XTN2.pdb.gz	IRS1_DROME Insulin receptor substrate 1 OS=Drosophila melanogaster OX=7227 GN=chico PE=1 SV=1
10	AFDB:Q91615	0.062	0.086	2.680E-24	885	0.291	0.441	Q91615.pdb.gz	IRS1A_XENLA Insulin receptor substrate 1-A OS=Xenopus laevis OX=8355 GN=irs1-a PE=1 SV=1
11	PDB:7c3mA	0.065	0.143	8.683E-5	577	0.035	0.081	7c3mA.pdb.gz
12	PDB:3pvuA	0.070	0.151	1.025E-4	609	0.015	0.033	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
13	PDB:3ljuX	0.103	0.296	1.083E-4	373	0.026	0.094	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
14	PDB:4mk0A	0.073	0.148	2.104E-4	631	0.016	0.033	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
15	PDB:3uzsA	0.072	0.153	4.826E-4	609	0.016	0.036	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
16	PDB:6xtbE	0.063	0.305	5.100E-4	235	0.026	0.149	6xtbE.pdb.gz
17	PDB:7nkyQ	0.050	0.147	1.236E-3	404	0.017	0.057	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
18	PDB:6s9wA	0.074	0.213	1.542E-3	411	0.023	0.075	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
19	PDB:4rm8A	0.066	0.226	2.996E-3	368	0.010	0.035	4rm8A.pdb.gz
20	PDB:6bbpA	0.061	0.151	3.537E-3	520	0.016	0.040	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F4P8	0.0	579	1099	0.368	0.448	E7F4P8_DANRE Insulin receptor substrate 1 OS=Danio rerio OX=7955 GN=irs1 PE=4 SV=1
2	F1MAL5	0.0	1868	1327	0.862	0.870	F1MAL5_RAT Insulin receptor substrate 2 OS=Rattus norvegicus OX=10116 GN=Irs2 PE=1 SV=2
3	O70360	0.0	559	332	0.216	0.870	O70360_RAT Insulin receptor substrate 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=IRS-2 PE=2 SV=1
4	P81122	0.0	1899	1321	0.857	0.868	IRS2_MOUSE Insulin receptor substrate 2 OS=Mus musculus OX=10090 GN=Irs2 PE=1 SV=2
5	Q7ZU74	0.0	842	1032	0.449	0.582	Q7ZU74_DANRE Insulin receptor substrate 2 OS=Danio rerio OX=7955 GN=irs2a PE=2 SV=1
6	Q9DF49	0.0	595	1074	0.351	0.438	IRS2A_XENLA Insulin receptor substrate 2-A OS=Xenopus laevis OX=8355 GN=irs2-a PE=2 SV=2
7	Q9Y4H2	0.0	2644	1338	1.000	1.000	IRS2_HUMAN Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2
8	P35568	1.55e-158	511	1242	0.320	0.345	IRS1_HUMAN Insulin receptor substrate 1 OS=Homo sapiens OX=9606 GN=IRS1 PE=1 SV=1
9	P35570	2.90e-154	499	1235	0.318	0.344	IRS1_RAT Insulin receptor substrate 1 OS=Rattus norvegicus OX=10116 GN=Irs1 PE=1 SV=1
10	P35569	3.18e-154	499	1233	0.330	0.358	IRS1_MOUSE Insulin receptor substrate 1 OS=Mus musculus OX=10090 GN=Irs1 PE=1 SV=1
11	Q91615	4.45e-111	373	885	0.286	0.432	IRS1A_XENLA Insulin receptor substrate 1-A OS=Xenopus laevis OX=8355 GN=irs1-a PE=1 SV=1
12	O14654	8.40e-72	266	1257	0.112	0.119	IRS4_HUMAN Insulin receptor substrate 4 OS=Homo sapiens OX=9606 GN=IRS4 PE=1 SV=1
13	Q9Z0Y7	1.05e-69	259	1216	0.115	0.127	IRS4_MOUSE Insulin receptor substrate 4 OS=Mus musculus OX=10090 GN=Irs4 PE=1 SV=2
14	B1WBQ1	1.95e-49	186	494	0.085	0.231	B1WBQ1_RAT Insulin receptor substrate 3 OS=Rattus norvegicus OX=10116 GN=Irs3 PE=4 SV=1
15	O08724	2.23e-49	186	494	0.085	0.231	O08724_RAT Insulin receptor substrate-3 OS=Rattus norvegicus OX=10116 GN=Irs3 PE=2 SV=1
16	Q4QQK2	2.72e-47	176	362	0.085	0.315	Q4QQK2_MOUSE Insulin receptor substrate 3 OS=Mus musculus OX=10090 GN=Irs3 PE=2 SV=1
17	O54718	4.33e-46	176	495	0.085	0.230	O54718_MOUSE Insulin receptor substrate-3 (Fragment) OS=Mus musculus OX=10090 GN=Irs3 PE=2 SV=1
18	Q9XTN2	3.08e-38	158	968	0.082	0.114	IRS1_DROME Insulin receptor substrate 1 OS=Drosophila melanogaster OX=7227 GN=chico PE=1 SV=1
19	F6NTT0	1.10e-07	58.9	712	0.028	0.053	F6NTT0_DANRE GRB2-associated-binding protein 1 OS=Danio rerio OX=7955 GN=fb11b01 PE=3 SV=2
20	F1Q7S5	1.29e-07	58.5	740	0.028	0.050	F1Q7S5_DANRE GRB2-associated-binding protein 1 OS=Danio rerio OX=7955 GN=fb11b01 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02174 IRS	1.3e-28	110.1	PTB domain (IRS-1 type)
2	PF19431 MEKK4_N	37	13.4	MEKK4 N-terminal
3	PF00169 PH	0.023	26.5	PH domain
4	PF15413 PH_11	31	16.5	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365016

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376345	0.999	Growth factor receptor-bound protein 2
2	9606.ENSP00000428056	0.999	Phosphatidylinositol 3-kinase regulatory subunit alpha
3	9606.ENSP00000268035	0.998	Insulin-like growth factor 1 receptor
4	9606.ENSP00000263967	0.988	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
5	9606.ENSP00000302665	0.986	Insulin-like growth factor I
6	9606.ENSP00000380432	0.983	Insulin
7	9606.ENSP00000303830	0.982	Insulin receptor
8	9606.ENSP00000371067	0.980	Tyrosine-protein kinase JAK2
9	9606.ENSP00000379111	0.976	Interleukin-4 receptor subunit alpha
10	9606.ENSP00000381793	0.973	Growth factor receptor-bound protein 10
11	9606.ENSP00000289153	0.966	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
12	9606.ENSP00000343204	0.961	Tyrosine-protein kinase JAK1
13	9606.ENSP00000222139	0.956	Erythropoietin receptor
14	9606.ENSP00000300574	0.956	Adapter molecule crk
15	9606.ENSP00000222254	0.955	Phosphatidylinositol 3-kinase regulatory subunit beta
16	9606.ENSP00000263025	0.950	Mitogen-activated protein kinase 3
17	9606.ENSP00000391676	0.948	Tyrosine-protein kinase JAK3
18	9606.ENSP00000262741	0.947	Phosphatidylinositol 3-kinase regulatory subunit gamma
19	9606.ENSP00000231449	0.946	Interleukin-4
20	9606.ENSP00000330341	0.945	Suppressor of cytokine signaling 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0005102	0.968	signaling receptor binding
GO:0019899	0.947	enzyme binding
GO:0043548	0.895	phosphatidylinositol 3-kinase binding
GO:0019901	0.651	protein kinase binding
GO:1990782	0.410	protein tyrosine kinase binding
GO:0030971	0.373	receptor tyrosine kinase binding
GO:0005068	0.339	transmembrane receptor protein tyrosine kinase adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0051716	0.994	cellular response to stimulus
GO:0042221	0.986	response to chemical
GO:0007169	0.981	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048522	0.975	positive regulation of cellular process
GO:0019222	0.972	regulation of metabolic process
GO:0070887	0.960	cellular response to chemical stimulus
GO:0048519	0.941	negative regulation of biological process
GO:0032869	0.939	cellular response to insulin stimulus
GO:0031323	0.936	regulation of cellular metabolic process
GO:0008286	0.933	insulin receptor signaling pathway
GO:0048523	0.877	negative regulation of cellular process
GO:0060255	0.855	regulation of macromolecule metabolic process
GO:0080090	0.848	regulation of primary metabolic process
GO:0008152	0.843	metabolic process
GO:0071704	0.794	organic substance metabolic process
GO:0044238	0.788	primary metabolic process
GO:0009893	0.761	positive regulation of metabolic process
GO:0032879	0.714	regulation of localization
GO:0031325	0.693	positive regulation of cellular metabolic process
GO:0051049	0.647	regulation of transport
GO:0009889	0.637	regulation of biosynthetic process
GO:0010556	0.634	regulation of macromolecule biosynthetic process
GO:0031326	0.634	regulation of cellular biosynthetic process
GO:0010604	0.619	positive regulation of macromolecule metabolic process
GO:0010646	0.594	regulation of cell communication
GO:0023051	0.593	regulation of signaling
GO:0048583	0.564	regulation of response to stimulus
GO:0032501	0.477	multicellular organismal process
GO:0042592	0.472	homeostatic process
GO:0032502	0.471	developmental process
GO:0048856	0.459	anatomical structure development
GO:0065009	0.457	regulation of molecular function
GO:0044237	0.453	cellular metabolic process
GO:0042127	0.452	regulation of cell population proliferation
GO:0048878	0.433	chemical homeostasis
GO:0051171	0.430	regulation of nitrogen compound metabolic process
GO:0010647	0.430	positive regulation of cell communication
GO:0023056	0.429	positive regulation of signaling
GO:0009966	0.423	regulation of signal transduction
GO:0051239	0.405	regulation of multicellular organismal process
GO:0048584	0.355	positive regulation of response to stimulus
GO:0051174	0.347	regulation of phosphorus metabolic process
GO:0031328	0.343	positive regulation of cellular biosynthetic process
GO:0042325	0.335	regulation of phosphorylation
GO:0006950	0.324	response to stress
GO:0009967	0.317	positive regulation of signal transduction
GO:0051050	0.314	positive regulation of transport
GO:0051173	0.306	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005886	0.998	plasma membrane
GO:0043227	0.800	membrane-bounded organelle
GO:0043231	0.786	intracellular membrane-bounded organelle
GO:0032991	0.584	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]