StarFunc result for job id Q9Y4I1

User Input

>input (1855 residues)
MAASELYTKFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEYHLDPKTKELP
HLRNPDILVGENDLTALSYLHEPAVLHNLRVRFIDSKLIYTYCGIVLVAINPYEQLPIYG
EDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYF
ATVSGSASEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMR
TYLLEKSRVVFQAEEERNYHIFYQLCASAKLPEFKMLRLGNADNFNYTKQGGSPVIEGVD
DAKEMAHTRQACTLLGISESHQMGIFRILAGILHLGNVGFTSRDADSCTIPPKHEPLCIF
CELMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVDNVN
QALHSAVKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKE
QIPWTLIDFYDNQPCINLIESKLGILDLLDEECKMPKGTDDTWAQKLYNTHLNKCALFEK
PRLSNKAFIIQHFADKVEYQCEGFLEKNKDTVFEEQIKVLKSSKFKMLPELFQDDEKAIS
PTSATSSGRTPLTRTPAKPTKGRPGQMAKEHKKTVGHQFRNSLHLLMETLNATTPHYVRC
IKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVL
SDRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRGW
LLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAA
TIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHYKRSMHAIIYLQCCFRRMM
AKRELKKLKIEARSVERYKKLHIGMENKIMQLQRKVDEQNKDYKCLVEKLTNLEGIYNSE
TEKLRSDLERLQLSEEEAKVATGRVLSLQEEIAKLRKDLEQTRSEKKCIEEHADRYKQET
EQLVSNLKEENTLLKQEKEALNHRIVQQAKEMTETMEKKLVEETKQLELDLNDERLRYQN
LLNEFSRLEERYDDLKEEMTLMVHVPKPGHKRTDSTHSSNESEYIFSSEIAEMEDIPSRT
EEPSEKKVPLDMSLFLKLQKRVTELEQEKQVMQDELDRKEEQVLRSKAKEEERPQIRGAE
LEYESLKRQELESENKKLKNELNELRKALSEKSAPEVTAPGAPAYRVLMEQLTSVSEELD
VRKEEVLILRSQLVSQKEAIQPKDDKNTMTDSTILLEDVQKMKDKGEIAQAYIGLKETNR
SSALDYHELNEDGELWLVYEGLKQANRLLESQLQSQKRSHENEAEALRGEIQSLKEENNR
QQQLLAQNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKI
GELEVGQMENISPGQIIDEPIRPVNIPRKEKDFQGMLEYKKEDEQKLVKNLILELKPRGV
AVNLIPGLPAYILFMCVRHADYLNDDQKVRSLLTSTINSIKKVLKKRGDDFETVSFWLSN
TCRFLHCLKQYSGEEGFMKHNTSRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVRVLENI
LQPMIVSGMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSILRQLNSFHSVMCQHGM
DPELIKQVVKQMFYIIGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGA
KETLEPLIQAAQLLQVKKKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSF
IRTIQMRLRDRKDSPQLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFISRV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IPW9	0.407	0.411	0.000	1839	0.616	0.621	A0A0R4IPW9.pdb.gz
2	AFDB:A1Z6Z8	0.517	0.531	0.000	1800	0.397	0.409	A1Z6Z8.pdb.gz	A1Z6Z8_DROME Dilute class unconventional myosin, isoform C OS=Drosophila melanogaster OX=7227 GN=didum PE=1 SV=1
3	AFDB:P21271	0.437	0.445	0.000	1818	0.611	0.623	P21271.pdb.gz	MYO5B_MOUSE Unconventional myosin-Vb OS=Mus musculus OX=10090 GN=Myo5b PE=1 SV=2
4	AFDB:P70569	0.453	0.455	0.000	1846	0.616	0.619	P70569.pdb.gz	MYO5B_RAT Unconventional myosin-Vb OS=Rattus norvegicus OX=10116 GN=Myo5b PE=1 SV=1
5	AFDB:Q02440	0.512	0.519	0.000	1829	0.905	0.917	Q02440.pdb.gz	MYO5A_CHICK Unconventional myosin-Va OS=Gallus gallus OX=9031 GN=MYO5A PE=1 SV=1
6	AFDB:Q9NQX4	0.412	0.438	0.000	1742	0.500	0.532	Q9NQX4.pdb.gz	MYO5C_HUMAN Unconventional myosin-Vc OS=Homo sapiens OX=9606 GN=MYO5C PE=1 SV=2
7	AFDB:Q9ULV0	0.443	0.444	0.000	1848	0.626	0.629	Q9ULV0.pdb.gz	MYO5B_HUMAN Unconventional myosin-Vb OS=Homo sapiens OX=9606 GN=MYO5B PE=1 SV=3
8	AFDB:Q9Y4I1	1.000	1.000	0.000	1855	1.000	1.000	Q9Y4I1.pdb.gz	MYO5A_HUMAN Unconventional myosin-Va OS=Homo sapiens OX=9606 GN=MYO5A PE=1 SV=2
9	AFDB:P19524	0.409	0.476	1.965E-96	1574	0.310	0.365	P19524.pdb.gz	MYO2_YEAST Myosin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MYO2 PE=1 SV=1
10	AFDB:Q5AKW2	0.398	0.470	2.278E-95	1561	0.300	0.356	Q5AKW2.pdb.gz	Q5AKW2_CANAL Myosin 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO2 PE=3 SV=1
11	PDB:4pa0A	0.367	0.687	4.816E-61	974	0.159	0.303	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
12	PDB:4pa0B	0.363	0.719	1.246E-59	920	0.155	0.313	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4p7hB	0.359	0.690	1.360E-56	952	0.153	0.298	4p7hB.pdb.gz
14	PDB:4anjA	0.320	0.580	1.464E-54	995	0.148	0.275	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
15	PDB:6ycxB	0.337	0.739	9.932E-51	817	0.130	0.296	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
16	PDB:5tbyA	0.317	0.582	7.694E-44	954	0.181	0.352	5tbyA.pdb.gz
17	PDB:7mf3B	0.331	0.657	2.051E-43	896	0.181	0.374	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
18	PDB:7qpgW	0.111	0.235	2.967E-2	779	0.022	0.051	7qpgW.pdb.gz
19	PDB:3wyfC	0.069	0.100	1.350E-1	1040	0.020	0.036	3wyfC.pdb.gz	Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
20	PDB:5yfpC	0.103	0.210	1.411E-1	794	0.022	0.052	5yfpC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A1Z6Z8	1237	1800	0.406	0.419	A1Z6Z8_DROME Dilute class unconventional myosin, isoform C OS=Drosophila melanogaster OX=7227 GN=didum PE=1 SV=1
2	A1Z6Z9	1238	1792	0.406	0.421	A1Z6Z9_DROME Dilute class unconventional myosin, isoform A OS=Drosophila melanogaster OX=7227 GN=didum PE=1 SV=1
3	A1Z700	990	1196	0.302	0.468	A1Z700_DROME Dilute class unconventional myosin, isoform B OS=Drosophila melanogaster OX=7227 GN=didum PE=3 SV=1
4	B0CN59	709	1512	0.246	0.302	B0CN59_NICBE Myosin XI-2 OS=Nicotiana benthamiana OX=4100 PE=2 SV=1
5	B0CN60	694	1569	0.229	0.270	B0CN60_NICBE Myosin XI-F OS=Nicotiana benthamiana OX=4100 PE=2 SV=1
6	B0CN61	699	1529	0.235	0.285	B0CN61_NICBE Myosin XI-K OS=Nicotiana benthamiana OX=4100 PE=2 SV=1
7	F1QKS0	2286	1838	0.622	0.627	F1QKS0_DANRE Myosin VB OS=Danio rerio OX=7955 GN=cb1077 PE=3 SV=3
8	F4HWY6	679	1529	0.230	0.279	MYO11_ARATH Myosin-11 OS=Arabidopsis thaliana OX=3702 GN=XI-E PE=3 SV=1
9	F4HXP9	692	1538	0.220	0.265	MYO9_ARATH Myosin-9 OS=Arabidopsis thaliana OX=3702 GN=XI-C PE=2 SV=1
10	F4I460	702	1500	0.235	0.290	MYO8_ARATH Myosin-8 OS=Arabidopsis thaliana OX=3702 GN=XI-B PE=3 SV=1
11	F4I507	633	1153	0.203	0.326	MYO3_ARATH Myosin-3 OS=Arabidopsis thaliana OX=3702 GN=VIII-A PE=2 SV=1
12	F4I5Q6	695	1730	0.230	0.247	MYO7_ARATH Myosin-7 OS=Arabidopsis thaliana OX=3702 GN=XI-A PE=3 SV=1
13	F4IRU3	713	1556	0.222	0.264	MYO12_ARATH Myosin-12 OS=Arabidopsis thaliana OX=3702 GN=XI-F PE=2 SV=1
14	F4IUG9	697	1493	0.243	0.301	MYO13_ARATH Myosin-13 OS=Arabidopsis thaliana OX=3702 GN=XI-G PE=3 SV=1
15	F4IVR7	698	1770	0.233	0.244	MYO10_ARATH Myosin-10 OS=Arabidopsis thaliana OX=3702 GN=XI-D PE=3 SV=1
16	F4JIU4	580	1134	0.173	0.283	MYO4_ARATH Myosin-4 OS=Arabidopsis thaliana OX=3702 GN=VIII-B PE=3 SV=1
17	F4JM19	703	1516	0.247	0.303	MYO14_ARATH Myosin-14 OS=Arabidopsis thaliana OX=3702 GN=XI-H PE=3 SV=1
18	F4K0A6	611	1220	0.184	0.280	MYO2_ARATH Myosin-2 OS=Arabidopsis thaliana OX=3702 GN=VIII-2 PE=2 SV=1
19	F4K5J1	711	1531	0.237	0.287	MYO17_ARATH Myosin-17 OS=Arabidopsis thaliana OX=3702 GN=XI-K PE=1 SV=2
20	F4K7C5	707	1565	0.236	0.280	F4K7C5_ARATH Myosin 2 OS=Arabidopsis thaliana OX=3702 GN=MYA2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	3.8e+02	12.8	AAA ATPase domain
2	PF13401 AAA_22	69	15.2	AAA domain
3	PF18504 Csm1_N	11	17.7	Csm1 N-terminal domain
4	PF15153 CYTL1	5.5e+02	11.9	Cytokine-like protein 1
5	PF01843 DIL	1.6e-29	113.6	DIL domain
6	PF19506 DUF6040	9.5	17.1	Family of unknown function (DUF6040)
7	PF00612 IQ	1.8e-23	91.1	IQ calmodulin-binding motif
8	PF00063 Myosin_head	1.7e-285	960.3	Myosin head (motor domain)
9	PF02736 Myosin_N	34	15.6	Myosin N-terminal SH3-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382177

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379601	0.999	Ras-related protein Rab-27A
2	9606.ENSP00000261890	0.998	Ras-related protein Rab-11A
3	9606.ENSP00000264605	0.998	Melanophilin
4	9606.ENSP00000301972	0.995	Rab effector MyRIP
5	9606.ENSP00000253861	0.984	Exocyst complex component 4
6	9606.ENSP00000260762	0.983	Exocyst complex component 6
7	9606.ENSP00000477310	0.980	Dynein light chain 2, cytoplasmic
8	9606.ENSP00000425587	0.973	Exocyst complex component 3
9	9606.ENSP00000334100	0.966	Exocyst complex component 7
10	9606.ENSP00000300935	0.964	Ras-related protein Rab-8A
11	9606.ENSP00000484855	0.957	Exocyst complex component 5
12	9606.ENSP00000264710	0.955	Ras-related protein Rab-10
13	9606.ENSP00000230449	0.954	Exocyst complex component 2
14	9606.ENSP00000216181	0.953	Myosin-9
15	9606.ENSP00000355605	0.946	Exocyst complex component 8
16	9606.ENSP00000352834	0.938	Unconventional myosin-Ic
17	9606.ENSP00000005257	0.934	Ras-related protein Ral-A
18	9606.ENSP00000222256	0.933	Ras-related protein Rab-3A
19	9606.ENSP00000245503	0.932	Myosin-2
20	9606.ENSP00000380432	0.925	Insulin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0000146	0.998	microfilament motor activity
GO:0019899	0.970	enzyme binding
GO:0051020	0.951	GTPase binding
GO:0031267	0.941	small GTPase binding
GO:0097159	0.875	organic cyclic compound binding
GO:1901363	0.874	heterocyclic compound binding
GO:0043167	0.710	ion binding
GO:0008092	0.578	cytoskeletal protein binding
GO:0043168	0.454	anion binding
GO:0003723	0.409	RNA binding
GO:0035639	0.339	purine ribonucleoside triphosphate binding
GO:0032555	0.321	purine ribonucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0051179	0.989	localization
GO:0051234	0.956	establishment of localization
GO:0065007	0.954	biological regulation
GO:0006810	0.926	transport
GO:0051641	0.924	cellular localization
GO:0030029	0.916	actin filament-based process
GO:0051649	0.866	establishment of localization in cell
GO:0051640	0.865	organelle localization
GO:0050789	0.841	regulation of biological process
GO:0050794	0.834	regulation of cellular process
GO:0071840	0.780	cellular component organization or biogenesis
GO:0016043	0.748	cellular component organization
GO:0046907	0.745	intracellular transport
GO:0030048	0.666	actin filament-based movement
GO:0032501	0.581	multicellular organismal process
GO:0030705	0.539	cytoskeleton-dependent intracellular transport
GO:0048518	0.393	positive regulation of biological process
GO:0006996	0.385	organelle organization
GO:0016192	0.377	vesicle-mediated transport
GO:0048522	0.375	positive regulation of cellular process
GO:0050896	0.342	response to stimulus
GO:0032502	0.319	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0031982	0.998	vesicle
GO:0032991	0.997	protein-containing complex
GO:0015629	0.997	actin cytoskeleton
GO:0120025	0.987	plasma membrane bounded cell projection
GO:0012505	0.985	endomembrane system
GO:0030054	0.977	cell junction
GO:0005829	0.973	cytosol
GO:0016020	0.972	membrane
GO:0099080	0.956	supramolecular complex
GO:0005576	0.938	extracellular region
GO:0031410	0.935	cytoplasmic vesicle
GO:0099512	0.926	supramolecular fiber
GO:0005615	0.903	extracellular space
GO:0043230	0.902	extracellular organelle
GO:0071944	0.877	cell periphery
GO:0031090	0.871	organelle membrane
GO:0099513	0.851	polymeric cytoskeletal fiber
GO:0070062	0.819	extracellular exosome
GO:0005886	0.797	plasma membrane
GO:0005884	0.786	actin filament
GO:0045202	0.753	synapse
GO:0036477	0.704	somatodendritic compartment
GO:0044297	0.697	cell body
GO:0012506	0.559	vesicle membrane
GO:0016459	0.541	myosin complex
GO:0030659	0.521	cytoplasmic vesicle membrane
GO:0070013	0.419	intracellular organelle lumen
GO:0005768	0.385	endosome
GO:0098588	0.357	bounding membrane of organelle
GO:0043025	0.341	neuronal cell body
GO:0031941	0.331	filamentous actin
GO:0055037	0.323	recycling endosome
GO:0005634	0.315	nucleus
GO:0098978	0.306	glutamatergic synapse
GO:0005654	0.301	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.998	myosin ATPase.

[back to server]