StarFunc result for job id Q9Y4K0

User Input

>input (774 residues)
MERPLCSHLCSCLAMLALLSPLSLAQYDSWPHYPEYFQQPAPEYHQPQAPANVAKIQLRL
AGQKRKHSEGRVEVYYDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSYGKGEGP
IWLDNLHCTGNEATLAACTSNGWGVTDCKHTEDVGVVCSDKRIPGFKFDNSLINQIENLN
IQVEDIRIRAILSTYRKRTPVMEGYVEVKEGKTWKQICDKHWTAKNSRVVCGMFGFPGER
TYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQVSLDPMKNVTCENGLPAVVS
CVPGQVFSPDGPSRFRKAYKPEQPLVRLRGGAYIGEGRVEVLKNGEWGTVCDDKWDLVSA
SVVCRELGFGSAKEAVTGSRLGQGIGPIHLNEIQCTGNEKSIIDCKFNAESQGCNHEEDA
GVRCNTPAMGLQKKLRLNGGRNPYEGRVEVLVERNGSLVWGMVCGQNWGIVEAMVVCRQL
GLGFASNAFQETWYWHGDVNSNKVVMSGVKCSGTELSLAHCRHDGEDVACPQGGVQYGAG
VACSETAPDLVLNAEMVQQTTYLEDRPMFMLQCAMEENCLSASAAQTDPTTGYRRLLRFS
SQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLED
TECEGDIQKNYECANFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEV
AESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B5DF27	0.948	0.945	0.000	776	0.871	0.869	B5DF27.pdb.gz	LOXL2_RAT Lysyl oxidase homolog 2 OS=Rattus norvegicus OX=10116 GN=Loxl2 PE=2 SV=2
2	AFDB:F1QQC3	0.766	0.802	0.000	737	0.636	0.668	F1QQC3.pdb.gz	LOL2A_DANRE Lysyl oxidase homolog 2A OS=Danio rerio OX=7955 GN=loxl2a PE=2 SV=1
3	AFDB:Q9Y4K0	1.000	1.000	0.000	774	1.000	1.000	Q9Y4K0.pdb.gz	LOXL2_HUMAN Lysyl oxidase homolog 2 OS=Homo sapiens OX=9606 GN=LOXL2 PE=1 SV=1
4	AFDB:Q9Z175	0.744	0.763	3.852E-103	754	0.540	0.554	Q9Z175.pdb.gz	LOXL3_MOUSE Lysyl oxidase homolog 3 OS=Mus musculus OX=10090 GN=Loxl3 PE=1 SV=2
5	AFDB:Q924C6	0.749	0.765	6.216E-102	757	0.528	0.540	Q924C6.pdb.gz	LOXL4_MOUSE Lysyl oxidase homolog 4 OS=Mus musculus OX=10090 GN=Loxl4 PE=2 SV=2
6	AFDB:Q96JB6	0.753	0.770	9.105E-102	756	0.523	0.536	Q96JB6.pdb.gz	LOXL4_HUMAN Lysyl oxidase homolog 4 OS=Homo sapiens OX=9606 GN=LOXL4 PE=1 SV=1
7	AFDB:B8A4W9	0.702	0.675	3.559E-101	807	0.554	0.532	B8A4W9.pdb.gz	LOX3B_DANRE Lysyl oxidase homolog 3B OS=Danio rerio OX=7955 GN=loxl3b PE=2 SV=1
8	AFDB:Q9UGM3	0.150	0.075	9.804E-37	2413	0.243	0.078	Q9UGM3.pdb.gz	DMBT1_HUMAN Deleted in malignant brain tumors 1 protein OS=Homo sapiens OX=9606 GN=DMBT1 PE=1 SV=2
9	AFDB:Q60997	0.155	0.069	5.251E-35	2085	0.252	0.094	Q60997.pdb.gz	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2
10	AFDB:B3F5L5	0.201	0.165	2.261E-33	996	0.231	0.180	B3F5L5.pdb.gz	B3F5L5_MOUSE SCART2 splice variant B OS=Mus musculus OX=10090 GN=Scart2 PE=1 SV=1
11	PDB:2xrcC	0.115	0.189	6.104E-4	454	0.039	0.066	2xrcC.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
12	PDB:2xrcB	0.119	0.184	8.466E-4	485	0.039	0.062	2xrcB.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
13	PDB:7tysA	0.069	0.112	5.340E-2	361	0.025	0.053	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
14	PDB:7zdzA	0.072	0.134	2.087E-1	325	0.028	0.068	7zdzA.pdb.gz
15	PDB:7mjpA	0.066	0.113	3.229E-1	366	0.016	0.033	7mjpA.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
16	PDB:5dcaA	0.068	0.033	4.730E-1	1948	0.019	0.008	5dcaA.pdb.gz
17	PDB:5kwyC	0.056	0.202	5.275E-1	133	0.014	0.083	5kwyC.pdb.gz	Clues to the mechanism of cholesterol transfer from the structure of NPC1 middle lumenal domain bound to NPC2.
18	PDB:2q3zA	0.074	0.086	5.883E-1	655	0.013	0.015	2q3zA.pdb.gz	Transglutaminase 2 undergoes a large conformational change upon activation
19	PDB:3s3sA	0.082	0.100	7.727E-1	620	0.014	0.018	3s3sA.pdb.gz	Inhibitors of Transglutaminase 2: A therapeutic option in celiac disease
20	PDB:3fcsA	0.093	0.081	8.160E-1	913	0.023	0.020	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5DF27	0.0	1410	776	0.872	0.870	LOXL2_RAT Lysyl oxidase homolog 2 OS=Rattus norvegicus OX=10116 GN=Loxl2 PE=2 SV=2
2	B8A4W9	0.0	896	807	0.565	0.542	LOX3B_DANRE Lysyl oxidase homolog 3B OS=Danio rerio OX=7955 GN=loxl3b PE=2 SV=1
3	F1QQC3	0.0	1083	737	0.641	0.673	LOL2A_DANRE Lysyl oxidase homolog 2A OS=Danio rerio OX=7955 GN=loxl2a PE=2 SV=1
4	P58022	0.0	1406	776	0.864	0.862	LOXL2_MOUSE Lysyl oxidase homolog 2 OS=Mus musculus OX=10090 GN=Loxl2 PE=1 SV=2
5	P58215	0.0	879	753	0.541	0.556	LOXL3_HUMAN Lysyl oxidase homolog 3 OS=Homo sapiens OX=9606 GN=LOXL3 PE=1 SV=1
6	Q924C6	0.0	832	757	0.534	0.546	LOXL4_MOUSE Lysyl oxidase homolog 4 OS=Mus musculus OX=10090 GN=Loxl4 PE=2 SV=2
7	Q96JB6	0.0	858	756	0.526	0.538	LOXL4_HUMAN Lysyl oxidase homolog 4 OS=Homo sapiens OX=9606 GN=LOXL4 PE=1 SV=1
8	Q9Y4K0	0.0	1627	774	1.000	1.000	LOXL2_HUMAN Lysyl oxidase homolog 2 OS=Homo sapiens OX=9606 GN=LOXL2 PE=1 SV=1
9	Q9Z175	0.0	885	754	0.535	0.549	LOXL3_MOUSE Lysyl oxidase homolog 3 OS=Mus musculus OX=10090 GN=Loxl3 PE=1 SV=2
10	Q9UGM3	1.77e-70	254	2413	0.233	0.075	DMBT1_HUMAN Deleted in malignant brain tumors 1 protein OS=Homo sapiens OX=9606 GN=DMBT1 PE=1 SV=2
11	Q9V9X5	1.66e-68	232	360	0.173	0.372	Q9V9X5_DROME Lysyl oxidase-like OS=Drosophila melanogaster OX=7227 GN=Loxl1 PE=2 SV=1
12	Q6NYT8	1.31e-64	223	408	0.132	0.250	Q6NYT8_DANRE Lysyl oxidase homolog OS=Danio rerio OX=7955 GN=zgc:77447 PE=2 SV=1
13	F1QGY9	1.43e-64	224	445	0.143	0.249	F1QGY9_DANRE Lysyl oxidase homolog OS=Danio rerio OX=7955 GN=loxl5b PE=3 SV=1
14	A6MH35	3.28e-64	223	444	0.142	0.248	A6MH35_DANRE Lysyl oxidase homolog OS=Danio rerio OX=7955 GN=loxl5b PE=2 SV=1
15	P28301	1.19e-63	220	411	0.130	0.246	LYOX_MOUSE Protein-lysine 6-oxidase OS=Mus musculus OX=10090 GN=Lox PE=1 SV=1
16	P16636	1.57e-63	220	411	0.130	0.246	LYOX_RAT Protein-lysine 6-oxidase OS=Rattus norvegicus OX=10116 GN=Lox PE=1 SV=2
17	P28300	3.25e-63	219	417	0.129	0.240	LYOX_HUMAN Protein-lysine 6-oxidase OS=Homo sapiens OX=9606 GN=LOX PE=1 SV=2
18	Q60997	1.34e-60	225	2085	0.240	0.089	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2
19	Q2PS19	2.97e-60	214	526	0.136	0.200	Q2PS19_DANRE Lysyl oxidase homolog OS=Danio rerio OX=7955 GN=si:ch211-238c15.1 PE=2 SV=1
20	Q08397	1.66e-59	213	574	0.128	0.172	LOXL1_HUMAN Lysyl oxidase homolog 1 OS=Homo sapiens OX=9606 GN=LOXL1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08411 Exonuc_X-T_C	2.9e+02	12.0	Exonuclease C-terminal
2	PF09272 Hepsin-SRCR	0.00078	31.5	Hepsin, SRCR domain
3	PF01186 Lysyl_oxidase	1.4e-98	340.1	Lysyl oxidase
4	PF00530 SRCR	4.7e-88	301.4	Scavenger receptor cysteine-rich domain
5	PF15494 SRCR_2	1.6e-14	65.7	Scavenger receptor cysteine-rich domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373783

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244050	0.986	Zinc finger protein SNAI1
2	9606.ENSP00000351807	0.985	Elastin
3	9606.ENSP00000345008	0.957	Fibulin-5
4	9606.ENSP00000260702	0.956	Lysyl oxidase homolog 4
5	9606.ENSP00000305714	0.953	Bone morphogenetic protein 1
6	9606.ENSP00000231004	0.947	Protein-lysine 6-oxidase
7	9606.ENSP00000264094	0.940	Lysyl oxidase homolog 3
8	9606.ENSP00000261921	0.937	Lysyl oxidase homolog 1
9	9606.ENSP00000223061	0.928	Procollagen C-endopeptidase enhancer 1
10	9606.ENSP00000061240	0.927	Tolloid-like protein 1
11	9606.ENSP00000364685	0.926	Microfibrillar-associated protein 2
12	9606.ENSP00000352455	0.909	Microfibrillar-associated protein 5
13	9606.ENSP00000350630	0.907	Tolloid-like protein 2
14	9606.ENSP00000269216	0.857	Transcription factor GATA-6
15	9606.ENSP00000324173	0.817	78 kDa glucose-regulated protein
16	9606.ENSP00000346839	0.764	Fibronectin type III domain containing
17	9606.ENSP00000364979	0.689	Collagen alpha-1(IV) chain
18	9606.ENSP00000282903	0.662	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
19	9606.ENSP00000225964	0.649	Collagen alpha-1(I) chain
20	9606.ENSP00000308236	0.589	COMM domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140096	1.000	catalytic activity, acting on a protein
GO:0005515	1.000	protein binding
GO:0070492	1.000	oligosaccharide binding
GO:0016641	1.000	oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor
GO:0046914	0.998	transition metal ion binding
GO:0005507	0.993	copper ion binding
GO:0009055	0.991	electron transfer activity
GO:0005509	0.982	calcium ion binding
GO:0004720	0.802	protein-lysine 6-oxidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.981	positive regulation of cellular process
GO:0009987	0.978	cellular process
GO:0048856	0.975	anatomical structure development
GO:0050896	0.962	response to stimulus
GO:0032501	0.961	multicellular organismal process
GO:0007275	0.930	multicellular organism development
GO:0048519	0.901	negative regulation of biological process
GO:0051239	0.894	regulation of multicellular organismal process
GO:0048513	0.871	animal organ development
GO:0050793	0.867	regulation of developmental process
GO:0045597	0.860	positive regulation of cell differentiation
GO:0048731	0.856	system development
GO:0009653	0.772	anatomical structure morphogenesis
GO:2000026	0.771	regulation of multicellular organismal development
GO:0071704	0.749	organic substance metabolic process
GO:0044238	0.738	primary metabolic process
GO:0071840	0.683	cellular component organization or biogenesis
GO:0006807	0.673	nitrogen compound metabolic process
GO:0016043	0.649	cellular component organization
GO:0019222	0.639	regulation of metabolic process
GO:0051240	0.639	positive regulation of multicellular organismal process
GO:0001525	0.631	angiogenesis
GO:0043170	0.630	macromolecule metabolic process
GO:1901564	0.606	organonitrogen compound metabolic process
GO:0009888	0.557	tissue development
GO:0019538	0.525	protein metabolic process
GO:0048523	0.492	negative regulation of cellular process
GO:0030198	0.491	extracellular matrix organization
GO:0031323	0.488	regulation of cellular metabolic process
GO:0060255	0.485	regulation of macromolecule metabolic process
GO:0051171	0.482	regulation of nitrogen compound metabolic process
GO:0080090	0.481	regulation of primary metabolic process
GO:0030154	0.475	cell differentiation
GO:0010468	0.420	regulation of gene expression
GO:0036211	0.388	protein modification process
GO:0051716	0.341	cellular response to stimulus
GO:0006950	0.319	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.997	extracellular region
GO:0030312	0.997	external encapsulating structure
GO:0062023	0.993	collagen-containing extracellular matrix
GO:0070013	0.940	intracellular organelle lumen
GO:0043227	0.908	membrane-bounded organelle
GO:0005615	0.840	extracellular space
GO:0043231	0.832	intracellular membrane-bounded organelle
GO:0005737	0.665	cytoplasm
GO:0012505	0.463	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.4.3.-	1.000	With oxygen as acceptor.
RHEA:24544	0.802	H2O + L-lysyl-[protein] + O2 = (S)-2-amino-6-oxohexanoyl-[protein] + H2O2 + NH4(+)
EC:1.4.3.13	0.802	protein-lysine 6-oxidase.

[back to server]