StarFunc result for job id Q9Y4K1

User Input

>input (1723 residues)
MEKRSSGRRSGRRRGSQKSTDSPGADAELPESAARDDAVFDDEVAPNAASDNASAEKKVK
SPRAALDGGVASAASPESKPSPGTKGQLRGESDRSKQPPPASSPTKRKGRSRALEAVPAP
PASGPRAPAKESPPKRVPDPSPVTKGTAAESGEEAARAIPRELPVKSSSLLPEIKPEHKR
GPLPNHFNGRAEGGRSRELGRAAGAPGASDADGLKPRNHFGVGRSTVTTKVTLPAKPKHV
ELNLKTPKNLDSLGNEHNPFSQPVHKGNTATKISLFENKRTNSSPRHTDIRGQRNTPASS
KTFVGRAKLNLAKKAKEMEQPEKKVMPNSPQNGVLVKETAIETKVTVSEEEILPATRGMN
GDSSENQALGPQPNQDDKADVQTDAGCLSEPVASALIPVKDHKLLEKEDSEAADSKSLVL
ENVTDTAQDIPTTVDTKDLPPTAMPKPQHTFSDSQSPAESSPGPSLSLSAPAPGDVPKDT
CVQSPISSFPCTDLKVSENHKGCVLPVSRQNNEKMPLLELGGETTPPLSTERSPEAVGSE
CPSRVLVQVRSFVLPVESTQDVSSQVIPESSEVREVQLPTCHSNEPEVVSVASCAPPQEE
VLGNEHSHCTAELAAKSGPQVIPPASEKTLPIQAQSQGSRTPLMAESSPTNSPSSGNHLA
TPQRPDQTVTNGQDSPASLLNISAGSDDSVFDSSSDMEKFTEIIKQMDSAVCMPMKRKKA
RMPNSPAPHFAMPPIHEDHLEKVFDPKVFTFGLGKKKESQPEMSPALHLMQNLDTKSKLR
PKRASAEQSVLFKSLHTNTNGNSEPLVMPEINDKENRDVTNGGIKRSRLEKSALFSSLLS
SLPQDKIFSPSVTSVNTMTTAFSTSQNGSLSQSSVSQPTTEGAPPCGLNKEQSNLLPDNS
LKVFNFNSSSTSHSSLKSPSHMEKYPQKEKTKEDLDSRSNLHLPETKFSELSKLKNDDME
KANHIESVIKSNLPNCANSDTDFMGLFKSSRYDPSISFSGMSLSDTMTLRGSVQNKLNPR
PGKVVIYSEPDVSEKCIEVFSDIQDCSSWSLSPVILIKVVRGCWILYEQPNFEGHSIPLE
EGELELSGLWGIEDILERHEEAESDKPVVIGSIRHVVQDYRVSHIDLFTEPEGLGILSSY
FDDTEEMQGFGVMQKTCSMKVHWGTWLIYEEPGFQGVPFILEPGEYPDLSFWDTEEAYIG
SMRPLKMGGRKVEFPTDPKVVVYEKPFFEGKCVELETGMCSFVMEGGETEEATGDDHLPF
TSVGSMKVLRGIWVAYEKPGFTGHQYLLEEGEYRDWKAWGGYNGELQSLRPILGDFSNAH
MIMYSEKNFGSKGSSIDVLGIVANLKETGYGVKTQSINVLSGVWVAYENPDFTGEQYILD
KGFYTSFEDWGGKNCKISSVQPICLDSFTGPRRRNQIHLFSEPQFQGHSQSFEETTSQID
DSFSTKSCRVSGGSWVVYDGENFTGNQYVLEEGHYPCLSAMGCPPGATFKSLRFIDVEFS
EPTIILFEREDFKGKKIELNAETVNLRSLGFNTQIRSVQVIGGIWVTYEYGSYRGRQFLL
SPAEVPNWYEFSGCRQIGSLRPFVQKRIYFRLRNKATGLFMSTNGNLEDLKLLRIQVMED
VGADDQIWIYQEGCIKCRIAEDCCLTIVGSLVTSGSKLGLALDQNADSQFWSLKSDGRIY
SKLKPNLVLDIKGGTQYDQNHIILNTVSKEKFTQVWEAMVLYT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7k7uB	0.067	0.493	1.567E-14	187	0.034	0.316	7k7uB.pdb.gz
2	PDB:3lwkA	0.097	0.876	3.832E-14	182	0.034	0.324	3lwkA.pdb.gz
3	PDB:2v2uA	0.096	0.897	8.072E-14	173	0.032	0.318	2v2uA.pdb.gz
4	PDB:2nbrA	0.094	0.853	1.327E-13	173	0.033	0.324	2nbrA.pdb.gz
5	PDB:1a5dA	0.096	0.898	1.540E-13	173	0.031	0.306	1a5dA.pdb.gz
6	PDB:1zwmA	0.097	0.849	1.974E-13	177	0.031	0.299	1zwmA.pdb.gz
7	PDB:2kfbA	0.097	0.909	2.794E-13	174	0.030	0.293	2kfbA.pdb.gz
8	PDB:2m3tA	0.097	0.848	1.180E-12	178	0.031	0.303	2m3tA.pdb.gz
9	PDB:1vclA	0.070	0.259	1.337E-5	432	0.032	0.127	1vclA.pdb.gz	Crystal Structure of the Hemolytic Lectin CEL-III Isolated from the Marine Invertebrate Cucumaria echinata: IMPLICATIONS OF DOMAIN STRUCTURE FOR ITS MEMBRANE PORE-FORMATION MECHANISM
10	PDB:4qd2C	0.083	0.397	1.189E-4	286	0.026	0.154	4qd2C.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
11	AFDB:B7YZW3	0.039	0.035	1.035E-3	2064	0.110	0.092	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
12	AFDB:P47136	0.032	0.036	2.612E-2	1447	0.092	0.110	P47136.pdb.gz	BUD4_YEAST Bud site selection protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUD4 PE=1 SV=2
13	AFDB:Q924C5	0.031	0.031	2.745E-2	1678	0.103	0.105	Q924C5.pdb.gz	ALPK3_MOUSE Alpha-protein kinase 3 OS=Mus musculus OX=10090 GN=Alpk3 PE=1 SV=2
14	AFDB:E7F5U2	0.040	0.033	5.782E-2	2497	0.129	0.089	E7F5U2.pdb.gz
15	AFDB:Q54NE5	0.038	0.036	9.502E-2	1918	0.099	0.089	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
16	AFDB:B7Z0K1	0.032	0.041	9.986E-2	1137	0.089	0.135	B7Z0K1.pdb.gz	B7Z0K1_DROME Bitesize, isoform H OS=Drosophila melanogaster OX=7227 GN=btsz PE=4 SV=1
17	AFDB:E9Q4Y4	0.040	0.031	1.159E-1	2514	0.142	0.097	E9Q4Y4.pdb.gz	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
18	AFDB:A0A0U1RQE4	0.039	0.046	1.414E-1	1047	0.103	0.169	A0A0U1RQE4.pdb.gz	A0A0U1RQE4_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
19	AFDB:Q9VAW5	0.026	0.029	1.725E-1	1673	0.099	0.102	Q9VAW5.pdb.gz	LARP_DROME La-related protein 1 OS=Drosophila melanogaster OX=7227 GN=larp PE=1 SV=5
20	AFDB:A0A494C1M0	0.041	0.056	1.812E-1	1011	0.092	0.156	A0A494C1M0.pdb.gz	A0A494C1M0_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q68DQ2	1.25e-135	472	2970	0.162	0.094	CRBG3_HUMAN Very large A-kinase anchor protein OS=Homo sapiens OX=9606 GN=CRYBG3 PE=1 SV=3
2	P10066	2.04e-25	107	175	0.033	0.320	CRGB_RAT Gamma-crystallin B OS=Rattus norvegicus OX=10116 GN=Crygb PE=3 SV=3
3	P04344	6.24e-25	105	175	0.033	0.320	CRGB_MOUSE Gamma-crystallin B OS=Mus musculus OX=10090 GN=Crygb PE=2 SV=4
4	P10065	3.04e-24	103	174	0.034	0.333	CRGA_RAT Gamma-crystallin A OS=Rattus norvegicus OX=10116 GN=Cryga PE=3 SV=3
5	P62696	3.25e-24	104	205	0.038	0.322	CRBB2_MOUSE Beta-crystallin B2 OS=Mus musculus OX=10090 GN=Crybb2 PE=1 SV=2
6	P62697	3.25e-24	104	205	0.038	0.322	CRBB2_RAT Beta-crystallin B2 OS=Rattus norvegicus OX=10116 GN=Crybb2 PE=1 SV=2
7	P04345	9.06e-24	102	174	0.033	0.328	CRGA_MOUSE Gamma-crystallin A OS=Mus musculus OX=10090 GN=Cryga PE=2 SV=2
8	P02528	2.02e-23	101	174	0.033	0.328	CRGE_RAT Gamma-crystallin E OS=Rattus norvegicus OX=10116 GN=Cryge PE=1 SV=2
9	Q61597	4.20e-23	100	174	0.033	0.322	CRGC_MOUSE Gamma-crystallin C OS=Mus musculus OX=10090 GN=Crygc PE=1 SV=3
10	P43320	4.79e-23	101	205	0.038	0.322	CRBB2_HUMAN Beta-crystallin B2 OS=Homo sapiens OX=9606 GN=CRYBB2 PE=1 SV=2
11	Q03740	5.00e-23	100	174	0.033	0.322	CRGE_MOUSE Gamma-crystallin E OS=Mus musculus OX=10090 GN=Cryge PE=2 SV=4
12	P02529	1.27e-22	99.0	174	0.032	0.316	CRGC_RAT Gamma-crystallin C OS=Rattus norvegicus OX=10116 GN=Crygc PE=2 SV=4
13	P56374	2.70e-22	98.6	196	0.038	0.332	CRBA4_RAT Beta-crystallin A4 OS=Rattus norvegicus OX=10116 GN=Cryba4 PE=1 SV=2
14	P10067	3.25e-22	97.8	174	0.033	0.322	CRGD_RAT Gamma-crystallin D OS=Rattus norvegicus OX=10116 GN=Crygd PE=2 SV=2
15	Q9CXV3	3.34e-22	97.8	174	0.032	0.316	CRGF_MOUSE Gamma-crystallin F OS=Mus musculus OX=10090 GN=Crygf PE=2 SV=3
16	P53673	6.72e-22	97.4	196	0.039	0.342	CRBA4_HUMAN Beta-crystallin A4 OS=Homo sapiens OX=9606 GN=CRYBA4 PE=1 SV=3
17	P04342	1.03e-21	96.3	174	0.033	0.322	CRGD_MOUSE Gamma-crystallin D OS=Mus musculus OX=10090 GN=Crygd PE=2 SV=3
18	P10068	2.30e-21	95.1	174	0.032	0.316	CRGF_RAT Gamma-crystallin F OS=Rattus norvegicus OX=10116 GN=Crygf PE=3 SV=2
19	P53674	7.79e-21	96.3	252	0.037	0.254	CRBB1_HUMAN Beta-crystallin B1 OS=Homo sapiens OX=9606 GN=CRYBB1 PE=1 SV=2
20	P02524	1.13e-20	94.4	211	0.032	0.261	CRBB3_RAT Beta-crystallin B3 OS=Rattus norvegicus OX=10116 GN=Crybb3 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00030 Crystall	8.6e-133	444.1	Beta/Gamma crystallin
2	PF18258 IL4_i_Ig	5.5e-09	47.4	Interleukin-4 inducing immunoglobulin-binding domain
3	PF03995 Inhibitor_I36	0.71	21.2	Peptidase inhibitor family I36
4	PF14200 RicinB_lectin_2	5.4	19.1	Ricin-type beta-trefoil lectin domain-like
5	PF00652 Ricin_B_lectin	3.8e-05	35.4	Ricin-type beta-trefoil lectin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358062

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000412324	0.800	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
2	9606.ENSP00000215743	0.738	Stromelysin-3
3	9606.ENSP00000249396	0.661	NAD-dependent protein deacetylase sirtuin-2
4	9606.ENSP00000383392	0.640	Neural cell adhesion molecule 2
5	9606.ENSP00000337332	0.601	NAD-dependent protein deacetylase sirtuin-6
6	9606.ENSP00000329466	0.595	NAD-dependent protein deacetylase sirtuin-7
7	9606.ENSP00000304987	0.577	Phakinin
8	9606.ENSP00000422581	0.574	Probable E3 ubiquitin-protein ligase TRIML2
9	9606.ENSP00000212015	0.566	NAD-dependent protein deacetylase sirtuin-1
10	9606.ENSP00000476228	0.566	NAD-dependent protein deacylase sirtuin-5, mitochondrial
11	9606.ENSP00000202967	0.564	NAD-dependent protein lipoamidase sirtuin-4, mitochondrial
12	9606.ENSP00000372191	0.556	NAD-dependent protein deacetylase sirtuin-3, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005212	0.896	structural constituent of eye lens

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.912	cellular process
GO:0065007	0.846	biological regulation
GO:0050789	0.788	regulation of biological process
GO:0050794	0.760	regulation of cellular process
GO:0032501	0.625	multicellular organismal process
GO:0032502	0.476	developmental process
GO:0048856	0.461	anatomical structure development
GO:0071840	0.349	cellular component organization or biogenesis
GO:0016043	0.342	cellular component organization
GO:0007275	0.332	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005856	0.981	cytoskeleton
GO:0043231	0.979	intracellular membrane-bounded organelle
GO:0005737	0.976	cytoplasm
GO:0070013	0.976	intracellular organelle lumen
GO:0031981	0.960	nuclear lumen
GO:0005654	0.736	nucleoplasm
GO:0032991	0.564	protein-containing complex
GO:0071944	0.507	cell periphery
GO:0005829	0.504	cytosol
GO:0099080	0.452	supramolecular complex
GO:0099081	0.414	supramolecular polymer
GO:0015630	0.406	microtubule cytoskeleton
GO:0099513	0.398	polymeric cytoskeletal fiber
GO:0015629	0.396	actin cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]