StarFunc result for job id Q9Y4K3

User Input

>input (522 residues)
MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILK
DCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y4K3	1.000	1.000	9.244E-101	522	1.000	1.000	Q9Y4K3.pdb.gz	TRAF6_HUMAN TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1
2	AFDB:B5DF45	0.405	0.399	2.877E-88	530	0.874	0.860	B5DF45.pdb.gz	TRAF6_RAT TNF receptor-associated factor 6 OS=Rattus norvegicus OX=10116 GN=Traf6 PE=2 SV=1
3	AFDB:E1C626	0.397	0.382	3.818E-80	545	0.762	0.730	E1C626.pdb.gz	E1C626_CHICK TNF receptor-associated factor OS=Gallus gallus OX=9031 GN=TRAF6 PE=1 SV=2
4	AFDB:Q6DJN2	0.419	0.397	1.333E-77	556	0.672	0.631	Q6DJN2.pdb.gz	TRF6B_XENLA TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1
5	AFDB:Q3MV19	0.437	0.411	2.713E-76	556	0.669	0.628	Q3MV19.pdb.gz	TRF6A_XENLA TNF receptor-associated factor 6-A OS=Xenopus laevis OX=8355 GN=traf6-a PE=1 SV=1
6	AFDB:Q6IWL4	0.409	0.395	5.212E-69	542	0.579	0.557	Q6IWL4.pdb.gz	TRAF6_DANRE TNF receptor-associated factor 6 OS=Danio rerio OX=7955 GN=traf6 PE=1 SV=2
7	AFDB:Q6DEG0	0.321	0.295	6.897E-41	573	0.261	0.237	Q6DEG0.pdb.gz	Q6DEG0_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=zgc:92367 PE=2 SV=1
8	AFDB:A0A024R8H5	0.354	0.367	5.189E-39	501	0.251	0.261	A0A024R8H5.pdb.gz
9	AFDB:Q13114	0.311	0.288	6.514E-39	568	0.276	0.254	Q13114.pdb.gz	TRAF3_HUMAN TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2
10	AFDB:P39429	0.347	0.359	2.031E-38	501	0.247	0.257	P39429.pdb.gz	TRAF2_MOUSE TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1
11	PDB:5dkaA	0.149	0.687	1.886E-5	96	0.046	0.250	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
12	PDB:4r8pL	0.129	0.259	3.948E-3	254	0.061	0.126	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
13	PDB:2c2lA	0.120	0.221	5.878E-3	281	0.031	0.057	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
14	PDB:5gm6a	0.085	0.346	1.833E-2	123	0.031	0.130	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	PDB:5a31B	0.089	0.492	3.425E-2	84	0.027	0.167	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
16	PDB:3m62A	0.120	0.066	6.047E-2	955	0.017	0.009	3m62A.pdb.gz
17	PDB:3t6qC	0.102	0.271	8.035E-2	139	0.019	0.072	3t6qC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
18	PDB:4a0cF	0.078	0.469	1.009E-1	80	0.031	0.200	4a0cF.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
19	PDB:7z36B	0.091	0.106	1.130E-1	446	0.082	0.096	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
20	PDB:7qcdC	0.106	0.202	1.340E-1	267	0.021	0.041	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5DF45	0.0	933	530	0.877	0.864	TRAF6_RAT TNF receptor-associated factor 6 OS=Rattus norvegicus OX=10116 GN=Traf6 PE=2 SV=1
2	E1C626	0.0	837	545	0.762	0.730	E1C626_CHICK TNF receptor-associated factor OS=Gallus gallus OX=9031 GN=TRAF6 PE=1 SV=2
3	P70196	0.0	936	530	0.893	0.879	TRAF6_MOUSE TNF receptor-associated factor 6 OS=Mus musculus OX=10090 GN=Traf6 PE=1 SV=2
4	Q3MV19	0.0	716	556	0.672	0.631	TRF6A_XENLA TNF receptor-associated factor 6-A OS=Xenopus laevis OX=8355 GN=traf6-a PE=1 SV=1
5	Q6DJN2	0.0	699	556	0.676	0.635	TRF6B_XENLA TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1
6	Q6IWL4	0.0	608	542	0.586	0.565	TRAF6_DANRE TNF receptor-associated factor 6 OS=Danio rerio OX=7955 GN=traf6 PE=1 SV=2
7	Q9Y4K3	0.0	1093	522	1.000	1.000	TRAF6_HUMAN TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1
8	P39429	3.54e-56	197	501	0.262	0.273	TRAF2_MOUSE TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1
9	B5DFH7	1.81e-55	195	497	0.257	0.270	B5DFH7_RAT TNF receptor-associated factor OS=Rattus norvegicus OX=10116 GN=Traf2 PE=1 SV=1
10	Q12933	2.36e-54	192	501	0.262	0.273	TRAF2_HUMAN TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2
11	Q9BUZ4	1.37e-53	190	470	0.249	0.277	TRAF4_HUMAN TNF receptor-associated factor 4 OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1
12	Q61382	8.82e-52	185	470	0.243	0.270	TRAF4_MOUSE TNF receptor-associated factor 4 OS=Mus musculus OX=10090 GN=Traf4 PE=1 SV=2
13	Q13114	1.24e-51	187	568	0.268	0.246	TRAF3_HUMAN TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2
14	Q7T1K2	2.05e-51	184	470	0.257	0.285	Q7T1K2_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=traf4l PE=2 SV=1
15	Q60803	2.64e-51	186	567	0.268	0.247	TRAF3_MOUSE TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2
16	O00463	3.54e-46	171	557	0.274	0.257	TRAF5_HUMAN TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2
17	Q6DEG0	6.98e-44	165	573	0.264	0.241	Q6DEG0_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=zgc:92367 PE=2 SV=1
18	Q9UAC4	6.59e-43	161	475	0.236	0.259	Q9UAC4_DROME TRAF6 OS=Drosophila melanogaster OX=7227 GN=Traf6 PE=2 SV=1
19	F6SA91	1.06e-42	159	437	0.222	0.265	F6SA91_HUMAN TNF receptor-associated factor OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1
20	P70191	5.48e-42	160	558	0.268	0.251	TRAF5_MOUSE TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	1.2e+02	14.1	Afadin- and alpha -actinin-Binding
2	PF10473 CENP-F_leu_zip	6e+02	11.9	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
3	PF00751 DM	1.8e+02	13.5	DM DNA binding domain
4	PF01519 DUF16	2.2e+02	13.8	Protein of unknown function DUF16
5	PF11932 DUF3450	2.5e+02	12.4	Protein of unknown function (DUF3450)
6	PF07426 Dynactin_p22	1.3e+02	13.8	Dynactin subunit p22
7	PF06160 EzrA	2.1e+02	11.5	Septation ring formation regulator, EzrA
8	PF00038 Filament	3e+02	12.4	Intermediate filament protein
9	PF02050 FliJ	3e+02	13.0	Flagellar FliJ protein
10	PF04102 SlyX	5.1	19.1	SlyX
11	PF17082 Spc29	48	15.2	Spindle Pole Component 29
12	PF18048 TRAF6_Z2	3.1e-12	57.5	TNF receptor-associated factor 6 zinc finger 2
13	PF12718 Tropomyosin_1	31	16.2	Tropomyosin like
14	PF04564 U-box	25	16.4	U-box domain
15	PF06785 UPF0242	92	14.6	Uncharacterised protein family (UPF0242) N-terminus
16	PF00097 zf-C3HC4	6.1e-05	34.1	Zinc finger, C3HC4 type (RING finger)
17	PF13923 zf-C3HC4_2	2.4e-06	38.5	Zinc finger, C3HC4 type (RING finger)
18	PF13920 zf-C3HC4_3	0.0013	29.8	Zinc finger, C3HC4 type (RING finger)
19	PF15227 zf-C3HC4_4	0.016	26.6	zinc finger of C3HC4-type, RING
20	PF17123 zf-RING_11	35	15.6	RING-like zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000003845

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000018861	0.999	Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. Plays an important role in the cascades of cellular responses evoked by changes in the environment. Mediates signal transduction of TRAF6, various cytokines including interleukin-1 (IL-1), transforming growth factor-beta (TGFB), TGFB-related factors like BMP2 and BMP4, toll-like receptors (TLR), tumor necrosis factor receptor CD40 and B-cell receptor (BCR). Ceramides are also able to activate MAP3K7/TAK1. Once activated, acts as an upstream activator of the MKK/JNK signal transdu [...]
2	9601.ENSPPYP00000023353	0.999	Interleukin-1 receptor-associated kinase 1
3	9601.ENSPPYP00000023381	0.999	Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma
4	9601.ENSPPYP00000015673	0.998	Myeloid differentiation primary response protein MyD88
5	9601.ENSPPYP00000019131	0.998	Pongo abelii TGF-beta activated kinase 1/MAP3K7 binding protein 2 (TAB2), mRNA
6	9601.ENSPPYP00000010334	0.997	Tumor necrosis factor receptor superfamily, member 11a, NFKB activator
7	9601.ENSPPYP00000012072	0.997	Mitochondrial antiviral signaling protein
8	9601.ENSPPYP00000005053	0.996	Interleukin-1 receptor-associated kinase 4
9	9601.ENSPPYP00000010010	0.996	Nerve growth factor receptor
10	9601.ENSPPYP00000015274	0.996	Binds to the IL-1 type I receptor following IL-1 engagement, triggering intracellular signaling cascades leading to transcriptional up-regulation and mRNA stabilization
11	9601.ENSPPYP00000019084	0.996	Tumor necrosis factor, alpha-induced protein 3
12	9601.ENSPPYP00000003337	0.995	Interferon regulatory factor 7
13	9601.ENSPPYP00000010748	0.995	Uncharacterized protein
14	9601.ENSPPYP00000004627	0.994	Toll-interleukin 1 receptor (TIR) domain containing adaptor protein
15	9601.ENSPPYP00000012391	0.994	Uncharacterized protein
16	9601.ENSPPYP00000013210	0.994	May play a role in regulated exocytosis. Modulates the localization of synaptophysin/SYP into synaptic-like microvesicles and may therefore play a role in synaptic-like microvesicle formation and/or maturation (By similarity). Involved in the regulation of short- term and long-term synaptic plasticity (By similarity).
17	9601.ENSPPYP00000018045	0.994	annotation not available
18	9601.ENSPPYP00000008294	0.993	Deubiquitinase that specifically cleaves 'Lys-63'- and linear 'Met-1'-linked polyubiquitin chains and is involved in NF-kappa-B activation and TNF-alpha-induced necroptosis. Plays an important role in the regulation of pathways leading to NF-kappa-B activation. Contributes to the regulation of cell survival, proliferation and differentiation via its effects on NF-kappa-B activation. Negative regulator of Wnt signaling. Inhibits HDAC6 and thereby promotes acetylation of alpha-tubulin and stabilization of microtubules. Plays a role in the regulation of microtubule dynamics, and thereby c [...]
19	9601.ENSPPYP00000005399	0.990	Interleukin-1 receptor-associated kinase 3
20	9601.ENSPPYP00000005510	0.989	Ubiquitin-conjugating enzyme E2 N

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0061630	0.992	ubiquitin protein ligase activity
GO:0019899	0.975	enzyme binding
GO:0005102	0.956	signaling receptor binding
GO:0031625	0.940	ubiquitin protein ligase binding
GO:0019900	0.937	kinase binding
GO:0005126	0.925	cytokine receptor binding
GO:0019901	0.919	protein kinase binding
GO:0042802	0.918	identical protein binding
GO:0032813	0.891	tumor necrosis factor receptor superfamily binding
GO:0031624	0.870	ubiquitin conjugating enzyme binding
GO:0005164	0.865	tumor necrosis factor receptor binding
GO:0031435	0.830	mitogen-activated protein kinase kinase kinase binding
GO:0031996	0.589	thioesterase binding
GO:0043422	0.575	protein kinase B binding
GO:0042826	0.516	histone deacetylase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048518	0.980	positive regulation of biological process
GO:0007165	0.977	signal transduction
GO:0048522	0.973	positive regulation of cellular process
GO:0035556	0.971	intracellular signal transduction
GO:0060255	0.966	regulation of macromolecule metabolic process
GO:0009893	0.966	positive regulation of metabolic process
GO:0048583	0.964	regulation of response to stimulus
GO:0010604	0.960	positive regulation of macromolecule metabolic process
GO:0019221	0.949	cytokine-mediated signaling pathway
GO:0071347	0.937	cellular response to interleukin-1
GO:0002833	0.936	positive regulation of response to biotic stimulus
GO:0031323	0.931	regulation of cellular metabolic process
GO:0002682	0.928	regulation of immune system process
GO:0080090	0.928	regulation of primary metabolic process
GO:0051171	0.928	regulation of nitrogen compound metabolic process
GO:0032103	0.922	positive regulation of response to external stimulus
GO:0008152	0.920	metabolic process
GO:0002376	0.917	immune system process
GO:0044093	0.907	positive regulation of molecular function
GO:0023051	0.898	regulation of signaling
GO:0045089	0.894	positive regulation of innate immune response
GO:0071704	0.891	organic substance metabolic process
GO:0042127	0.891	regulation of cell population proliferation
GO:0043122	0.885	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0044238	0.878	primary metabolic process
GO:0002253	0.868	activation of immune response
GO:0001934	0.867	positive regulation of protein phosphorylation
GO:0002764	0.866	immune response-regulating signaling pathway
GO:0009607	0.863	response to biotic stimulus
GO:0001819	0.861	positive regulation of cytokine production
GO:0051091	0.861	positive regulation of DNA-binding transcription factor activity
GO:0002221	0.860	pattern recognition receptor signaling pathway
GO:0043123	0.857	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0009605	0.851	response to external stimulus
GO:0045859	0.845	regulation of protein kinase activity
GO:0044419	0.831	biological process involved in interspecies interaction between organisms
GO:0051092	0.829	positive regulation of NF-kappaB transcription factor activity
GO:0051707	0.820	response to other organism
GO:0051347	0.817	positive regulation of transferase activity
GO:1903037	0.816	regulation of leukocyte cell-cell adhesion
GO:0070647	0.813	protein modification by small protein conjugation or removal
GO:0006950	0.811	response to stress
GO:0045860	0.803	positive regulation of protein kinase activity
GO:0002224	0.799	toll-like receptor signaling pathway
GO:0002700	0.764	regulation of production of molecular mediator of immune response
GO:0008284	0.738	positive regulation of cell population proliferation
GO:0000209	0.714	protein polyubiquitination
GO:0048519	0.689	negative regulation of biological process
GO:0007249	0.685	I-kappaB kinase/NF-kappaB signaling
GO:1903039	0.683	positive regulation of leukocyte cell-cell adhesion
GO:0070534	0.652	protein K63-linked ubiquitination
GO:1901700	0.629	response to oxygen-containing compound
GO:0032147	0.612	activation of protein kinase activity
GO:0002768	0.583	immune response-regulating cell surface receptor signaling pathway
GO:0050793	0.567	regulation of developmental process
GO:0031328	0.508	positive regulation of cellular biosynthetic process
GO:0002718	0.492	regulation of cytokine production involved in immune response
GO:0010557	0.491	positive regulation of macromolecule biosynthetic process
GO:0048523	0.486	negative regulation of cellular process
GO:0033554	0.471	cellular response to stress
GO:0002819	0.401	regulation of adaptive immune response
GO:0045935	0.379	positive regulation of nucleobase-containing compound metabolic process
GO:0009892	0.335	negative regulation of metabolic process
GO:0010605	0.334	negative regulation of macromolecule metabolic process
GO:0032501	0.326	multicellular organismal process
GO:0044237	0.324	cellular metabolic process
GO:0032502	0.319	developmental process
GO:0031324	0.305	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0032991	0.998	protein-containing complex
GO:0005829	0.979	cytosol
GO:0043229	0.968	intracellular organelle
GO:0005886	0.956	plasma membrane
GO:0005634	0.888	nucleus
GO:0012505	0.701	endomembrane system
GO:0043232	0.607	intracellular non-membrane-bounded organelle
GO:0031982	0.533	vesicle
GO:0012506	0.445	vesicle membrane
GO:0031410	0.442	cytoplasmic vesicle
GO:0010008	0.392	endosome membrane
GO:0048471	0.349	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]