StarFunc result for job id Q9Y4L1

User Input

>input (999 residues)
MADKVRRQRPRRRVCWALVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVL
NKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARF
PEHELTFDPQRQTVHFQISSQLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPVFF
NQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGSGSTVC
TIVTYQMVKTKEAGMQPQLQIRGVGFDRTLGGLEMELRLRERLAGLFNEQRKGQRAKDVR
ENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLFERVP
GPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELGKNINADEAAAMGAV
YQAAALSKAFKVKPFVVRDAVVYPILVEFTREVEEEPGIHSLKHNKRVLFSRMGPYPQRK
VITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGDSFKKYPDYESKGIK
AHFNLDESGVLSLDRVESVFETLVEDSAEEESTLTKLGNTISSLFGGGTTPDAKENGTDT
VQEEEESPAEGSKDEPGEQVELKEEAEAPVEDGSQPPPPEPKGDATPEGEKATEKENGDK
SEAQKPSEKAEAGPEGVAPAPEGEKKQKPARKRRMVEEIGVELVVLDLPDLPEDKLAQSV
QKLQDLTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSAAST
WLEDEGVGATTVMLKEKLAELRKLCQGLFFRVEERKKWPERLSALDNLLNHSSMFLKGAR
LIPEMDQIFTEVEMTTLEKVINETWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDR
EVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQTEDAEPISEPEKV
ETGSEPGDTEPLELGGPGAEPEQKEQSTGQKRPLKNDEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63617	0.828	0.828	0.000	999	0.916	0.916	Q63617.pdb.gz	HYOU1_RAT Hypoxia up-regulated protein 1 OS=Rattus norvegicus OX=10116 GN=Hyou1 PE=1 SV=1
2	AFDB:O46067	0.753	0.812	4.964E-86	923	0.401	0.434	O46067.pdb.gz	O46067_DROME EG:25E8.1 protein OS=Drosophila melanogaster OX=7227 GN=Grp170 PE=1 SV=1
3	AFDB:Q22515	0.670	0.723	2.088E-75	921	0.305	0.331	Q22515.pdb.gz	Q22515_CAEEL Hypoxia up-regulated protein 1 OS=Caenorhabditis elegans OX=6239 GN=CELE_T14G8.3 PE=1 SV=2
4	AFDB:F4JMJ1	0.711	0.813	2.052E-66	867	0.275	0.317	F4JMJ1.pdb.gz	HSP7R_ARATH Heat shock 70 kDa protein 17 OS=Arabidopsis thaliana OX=3702 GN=HSP70-17 PE=2 SV=1
5	AFDB:Q61316	0.672	0.790	9.255E-59	841	0.242	0.288	Q61316.pdb.gz	HSP74_MOUSE Heat shock 70 kDa protein 4 OS=Mus musculus OX=10090 GN=Hspa4 PE=1 SV=1
6	AFDB:Q10061	0.637	0.740	1.440E-57	848	0.231	0.272	Q10061.pdb.gz	LHS1_SCHPO Heat shock protein 70 homolog lhs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1F5.06 PE=3 SV=1
7	AFDB:M9MSL3	0.642	0.758	1.046E-55	836	0.221	0.264	M9MSL3.pdb.gz	M9MSL3_DROME Hsc70Cb, isoform G OS=Drosophila melanogaster OX=7227 GN=Hsp110 PE=1 SV=1
8	AFDB:Q9VUC1	0.647	0.796	3.018E-55	804	0.209	0.260	Q9VUC1.pdb.gz	Q9VUC1_DROME Hsc70Cb, isoform A OS=Drosophila melanogaster OX=7227 GN=Hsp110 PE=1 SV=1
9	AFDB:Q388X2	0.670	0.817	5.060E-51	811	0.207	0.255	Q388X2.pdb.gz	Q388X2_TRYB2 Heat shock protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0880 PE=4 SV=1
10	AFDB:Q6FJI3	0.603	0.854	3.368E-48	694	0.196	0.282	Q6FJI3.pdb.gz	HSP7F_CANGA Heat shock protein homolog SSE1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SSE1 PE=3 SV=1
11	PDB:2qxlB	0.572	0.894	1.693E-44	625	0.175	0.280	2qxlB.pdb.gz	Insights into hsp70 chaperone activity from a crystal structure of the yeast hsp110 Sse1.
12	PDB:3c7nA	0.569	0.858	2.154E-44	649	0.178	0.274	3c7nA.pdb.gz	Structure of the Hsp110:Hsc70 nucleotide exchange machine
13	PDB:6asyA	0.539	0.868	2.212E-41	606	0.173	0.285	6asyA.pdb.gz	Conformation transitions of the polypeptide-binding pocket support an active substrate release from Hsp70s.
14	PDB:7kw7C	0.360	0.683	2.353E-34	511	0.146	0.286	7kw7C.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:7krwA	0.409	0.653	4.478E-32	608	0.162	0.266	7krwA.pdb.gz	Conformational equilibria in allosteric control of Hsp70 chaperones.
16	PDB:5fpnA	0.342	0.840	1.015E-31	379	0.127	0.335	5fpnA.pdb.gz	Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
17	PDB:6sr6C	0.340	0.624	2.458E-29	524	0.118	0.225	6sr6C.pdb.gz	The ribosome-associated complex RAC serves in a relay that directs nascent chains to Ssb.
18	PDB:7x3kB	0.339	0.643	1.264E-28	506	0.119	0.235	7x3kB.pdb.gz
19	PDB:6w6eI	0.326	0.853	6.247E-27	357	0.107	0.300	6w6eI.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.
20	PDB:1jcfA	0.261	0.713	2.038E-12	336	0.072	0.214	1jcfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O46067	0.0	666	923	0.394	0.427	O46067_DROME EG:25E8.1 protein OS=Drosophila melanogaster OX=7227 GN=Grp170 PE=1 SV=1
2	Q63617	0.0	1837	999	0.917	0.917	HYOU1_RAT Hypoxia up-regulated protein 1 OS=Rattus norvegicus OX=10116 GN=Hyou1 PE=1 SV=1
3	Q9JKR6	0.0	1833	999	0.921	0.921	HYOU1_MOUSE Hypoxia up-regulated protein 1 OS=Mus musculus OX=10090 GN=Hyou1 PE=1 SV=1
4	Q9Y4L1	0.0	2034	999	1.000	1.000	HYOU1_HUMAN Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1
5	Q22515	5.87e-132	423	921	0.228	0.248	Q22515_CAEEL Hypoxia up-regulated protein 1 OS=Caenorhabditis elegans OX=6239 GN=CELE_T14G8.3 PE=1 SV=2
6	F4JMJ1	5.55e-99	333	867	0.215	0.248	HSP7R_ARATH Heat shock 70 kDa protein 17 OS=Arabidopsis thaliana OX=3702 GN=HSP70-17 PE=2 SV=1
7	P48722	3.42e-90	308	838	0.250	0.298	HS74L_MOUSE Heat shock 70 kDa protein 4L OS=Mus musculus OX=10090 GN=Hspa4l PE=1 SV=2
8	Q92598	7.93e-90	308	858	0.256	0.298	HS105_HUMAN Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1 PE=1 SV=1
9	Q61699	6.30e-89	305	858	0.251	0.293	HS105_MOUSE Heat shock protein 105 kDa OS=Mus musculus OX=10090 GN=Hsph1 PE=1 SV=2
10	Q60446	2.07e-86	298	858	0.258	0.301	HS105_CRIGR Heat shock protein 105 kDa OS=Cricetulus griseus OX=10029 GN=HSPH1 PE=2 SV=1
11	Q10061	3.76e-85	295	848	0.158	0.186	LHS1_SCHPO Heat shock protein 70 homolog lhs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1F5.06 PE=3 SV=1
12	F4HQD4	5.56e-82	285	831	0.247	0.297	HSP7P_ARATH Heat shock 70 kDa protein 15 OS=Arabidopsis thaliana OX=3702 GN=HSP70-15 PE=1 SV=1
13	Q9S7C0	2.02e-75	267	831	0.246	0.296	HSP7O_ARATH Heat shock 70 kDa protein 14 OS=Arabidopsis thaliana OX=3702 GN=HSP70-14 PE=1 SV=1
14	O95757	2.30e-72	259	839	0.166	0.198	HS74L_HUMAN Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3
15	Q8INI8	4.19e-68	242	641	0.170	0.265	HSP72_DROME Major heat shock 70 kDa protein Ba OS=Drosophila melanogaster OX=7227 GN=Hsp70Ba PE=2 SV=2
16	Q9BIR7	4.19e-68	242	641	0.170	0.265	HSP75_DROME Major heat shock 70 kDa protein Bc OS=Drosophila melanogaster OX=7227 GN=Hsp70Bc PE=2 SV=2
17	Q9BIS2	4.19e-68	242	641	0.170	0.265	HSP73_DROME Major heat shock 70 kDa protein Bb OS=Drosophila melanogaster OX=7227 GN=Hsp70Bb PE=2 SV=2
18	Q9VG58	4.67e-68	242	641	0.170	0.265	HSP74_DROME Major heat shock 70 kDa protein Bbb OS=Drosophila melanogaster OX=7227 GN=Hsp70Bbb PE=3 SV=2
19	P02825	1.21e-67	241	642	0.169	0.263	HSP71_DROME Major heat shock 70 kDa protein Ab OS=Drosophila melanogaster OX=7227 GN=Hsp70Ab PE=2 SV=3
20	P82910	1.21e-67	241	642	0.169	0.263	HSP70_DROME Major heat shock 70 kDa protein Aa OS=Drosophila melanogaster OX=7227 GN=Hsp70Aa PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17194 AbiEi_3_N	46	15.5	Transcriptional regulator, AbiEi antitoxin N-terminal domain
2	PF00012 HSP70	2.3e-99	344.9	Hsp70 protein
3	PF06723 MreB_Mbl	0.012	26.1	MreB/Mbl protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480150

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324173	0.998	78 kDa glucose-regulated protein
2	9606.ENSP00000299767	0.997	Endoplasmin
3	9606.ENSP00000286091	0.996	Protein disulfide-isomerase A4
4	9606.ENSP00000264065	0.987	DnaJ homolog subfamily C member 10
5	9606.ENSP00000378294	0.987	Nucleotide exchange factor SIL1
6	9606.ENSP00000385385	0.981	Protein disulfide-isomerase A6
7	9606.ENSP00000357998	0.970	Translocation protein SEC63 homolog
8	9606.ENSP00000414398	0.969	DnaJ homolog subfamily B member 11
9	9606.ENSP00000327801	0.967	Protein disulfide-isomerase
10	9606.ENSP00000473631	0.964	DnaJ homolog subfamily C member 3
11	9606.ENSP00000216037	0.960	X-box-binding protein 1
12	9606.ENSP00000320866	0.960	Calreticulin
13	9606.ENSP00000432799	0.957	Mesencephalic astrocyte-derived neurotrophic factor
14	9606.ENSP00000247461	0.955	Calnexin
15	9606.ENSP00000331268	0.943	Ankyrin repeat domain-containing protein 45
16	9606.ENSP00000356687	0.943	Sodium/hydrogen exchanger 11
17	9606.ENSP00000243253	0.928	Protein transport protein Sec61 subunit alpha isoform 1
18	9606.ENSP00000300289	0.928	Protein disulfide-isomerase A3
19	9606.ENSP00000383938	0.920	Cysteine rich with EGF like domains 2
20	9606.ENSP00000185150	0.919	Endoplasmic reticulum lectin 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.515	heterocyclic compound binding
GO:0097159	0.512	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080135	0.997	regulation of cellular response to stress
GO:0043069	0.997	negative regulation of programmed cell death
GO:2001242	0.996	regulation of intrinsic apoptotic signaling pathway
GO:2001243	0.976	negative regulation of intrinsic apoptotic signaling pathway
GO:0050896	0.975	response to stimulus
GO:0009987	0.952	cellular process
GO:0006950	0.936	response to stress
GO:0009628	0.475	response to abiotic stimulus
GO:0051716	0.414	cellular response to stimulus
GO:0042221	0.348	response to chemical
GO:0070482	0.340	response to oxygen levels

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.998	endoplasmic reticulum
GO:0005576	0.985	extracellular region
GO:0016020	0.876	membrane
GO:0032991	0.852	protein-containing complex
GO:0070013	0.812	intracellular organelle lumen
GO:0005615	0.669	extracellular space
GO:0031982	0.480	vesicle
GO:0070062	0.360	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]